SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005055 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005055
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-37
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-19
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005055   Gene: ENSAMEG00000004793   Transcript: ENSAMET00000005263
Sequence length 350
Comment pep:novel scaffold:ailMel1:GL192793.1:1237184:1248734:-1 gene:ENSAMEG00000004793 transcript:ENSAMET00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASCKRMTSSSRSQVLLMWKPDKAQSGPHSVEKEALASRILRDTETCRQNFRNFPYPDL
AGPRKALNQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEV
VTLVEDLTHILEEEAPQNSALPQEIPEEDPKGRPAFQAGWLNDLVTKESMTFKDVAVDIT
QEDWEIMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEW
KAEAQECTPVTNISKLTKTGTQTVKLEEPYDYDERLGRQASDTFRKIPTNERNFALKSVL
SREDDCMEEYLSKYDIYRNNFEKHSNLIIQFGTQSDNKTMYDEGRATFSH
Download sequence
Identical sequences G1LDS3
ENSAMEP00000005055 ENSAMEP00000005055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]