SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005136 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005136
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 174-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005136   Gene: ENSAMEG00000004857   Transcript: ENSAMET00000005347
Sequence length 525
Comment pep:novel scaffold:ailMel1:GL194052.1:150784:192664:1 gene:ENSAMEG00000004857 transcript:ENSAMET00000005347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVINALTIISLVLLITILVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCMGS
TFFCHSNMCINSSLVCNGIQNCAYPWDENHCKEKKKAGLFEQVTKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQAHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences G1LE02
ENSAMEP00000005136 ENSAMEP00000005136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]