SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005171 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005171
Domain Number 1 Region: 54-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 2 Region: 131-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005171   Gene: ENSAMEG00000004900   Transcript: ENSAMET00000005383
Sequence length 268
Comment pep:novel scaffold:ailMel1:GL193827.1:76752:80748:-1 gene:ENSAMEG00000004900 transcript:ENSAMET00000005383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASGCMAQGGVRRTAALGLALRLLLGFGLGMEAAPTPVPIQFLAQAPVGPQSSSCPPTSF
QCRTSGFCVPLTMRCDGDKDCPDGSDEEECRNKPCAQDGECQPPTGSPCPCDNIDDCPDG
IVENVHNCSYQPCPAGELRCLLGGACIPHTWLCDGHPDCPASSDELGCGTETLKEGTDMS
TGTPVTPHSVTSLKNATATPVGDQDSVQSGYRSACGVIAAAVVLSAGVAAISLFVLSRLC
VRGRLHPLGLLTVVKESLLLSDRKTSLF
Download sequence
Identical sequences G1LE37
ENSAMEP00000005171 ENSAMEP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]