SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005307 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005307
Domain Number 1 Region: 962-1714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-255
Family Motor proteins 0.000000000231
Further Details:      
 
Domain Number 2 Region: 2635-2718
Classification Level Classification E-value
Superfamily SH3-domain 0.000000107
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 3 Region: 3072-3181
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000118
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000005307
Domain Number - Region: 3182-3232
Classification Level Classification E-value
Superfamily PH domain-like 0.00149
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005307   Gene: ENSAMEG00000004966   Transcript: ENSAMET00000005526
Sequence length 3297
Comment pep:novel scaffold:ailMel1:GL193001.1:579780:626973:-1 gene:ENSAMEG00000004966 transcript:ENSAMET00000005526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEDEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGL
HTGPQKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPR
AQSLSKASTAINWLTKKFLLKKAEESGSKQATLDAWLNRSGSRVGSRKLPFPSGAEILRH
GGRLRRFPRSRSIYASGEPVGFLPFEDEAPFRPSGSRKSLYGLEGFQDLGEYYDYHREGD
DYYDRQSLYQYEEEEPYLGYRPYDPYNPAWPPYGDHPYGYPPEDPYDYYHPDYYGGPYYP
TYPYGYGYDDYEPPYAPPAGYASPYSYYDGYQGEPYPHGYYLDPYAPYEAPYPPYSLPYD
LPYDVPYFDPYGVPYGAPYAEDVYGGGDRAIYPPEASYLYPEEPAFAYPWVPPPILSPHN
PYAHPMDDIAELEEPEEAGGERQGTSFRLPSAAFFEQQGMDKPARSKLSLIRRFRLFPRP
QVKLFGKEKLDVSLPPSLDIPLPLGDADEDEEEEEMAPVPPVPYAQPFWGFLTPRQRNLQ
RALSAFGAHRGPGFGADFGRPAPRPATSLARFLPPPPRRPRSLQEPPSPRRLSGRLGPPH
SPVLGSPRPPSPPPLLGHGARCRSLNLPSRLPHTWRRLSEPPTRAVKPRVRQPYPGPPSA
GSWPVAAAAPERRESQRESEDSETPWTVPPLAPRWDVDVPPTQRPPSPWPGGAGSPRSFS
RPPPVPENPFLQHVGPVRSPASWPEDPASDLTNVFLVRHQDPGPGQLVKSASPIPEKPEE
EATLGELQRPAEPEPSTPTPPKDSLPERRALSLSLSHPLATCDKMRATWPPWCRWGTLPS
SPAPLAPTRAPGPLPKAGERRPAGPGRFAVVMPQVQKLSAFQRVRPAALQPPVQVTQDPE
SSPKPRAWSLLWSCFWLPVEAHRRPWPQVLTSPQSCRLGPGANCLPHRGLWEEVGPKSWW
NKMHSIRNLPTTRFREQSREDGVEDMTQLEDLQETTVLSNLKTRFERNLIYTYIGSILVS
VNPYQMFGIYGPEHVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCIIISGESGSGK
TESTKLVLRYLAAMNQKRGITQQVQILEATPLLESFGNAKTVRNDNSSRFGKFVEVFLEG
GVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQG
GNCEISGKSDSDDFRRLLAAMEVLGFSGEDQDSIFRILASILHLGNVYFEKYETDAQETA
SVVSAREIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYA
LLFSWLIARVNALVSPQQDTLSIAILDIYGFEDLTFNSFEQLCINYANENLQYLFNKIVF
QEEQEEYIREQIDWREISFADNQPCINLISLKPYGILRILVTPTCPQATDHTFLQKCHYH
HGANPLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAYL
FSSHAPQAAPQRLGKSSSVTRLHKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKK
EPSLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRNHRYRCLVALKHNLPASG
DMCVSVLSRLCTVMPNMYRVGVSKLFLKEHLHQLLESMRERVVHQAALTLQRCLRGFLIR
RRFRSLRGQITLLQSRARGYLARQRYQQMRRNLVKFRSLVHTYMNHRHYLKLRAERRLRV
EEARLRELEELSKREVVAVGHLEVPAELAGLLQAVAGLRPARVPQVAPVRTPRLQAEPRV
TLPLDINNYPMAKFVRCHFKEPAFGMLTVPLKTPLLRLPAECHAEAVSVFKLILRFMGDP
RLYGAQENIFGNYIVQKGLAAPELRDEILVQLANQVWRNPSAHNAERGWLLLATCLSGFA
PSSRLTNYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTFPPTRLEWRATQEK
ASMALDVGCFNGDQFSCPVHSWSTGEEVAGDILKHRGLADGWRGWTVAMKSGVQWAELAG
HDYVLDLVSDLELLGDFPRQKSYFIVGAEGPVACRGGPRALFGNSWDSDEDTPTRPQAQG
HAPKVADSDGYCSHNEDVWGDQQEKRTWLLCPPSPQPDSDSLGEPSVPHKGLDGYLDSLF
DPVLSYGDADLEKPTAIAYRMKGGGQPGGSGSSSTEDPPRRPPEPKPKPIPGLDASTLAL
QQAFIHKQAILLAREMTLQAMALQQQPPSPTPRPLPLEKPLAPEARPKFVGTGPPAKPVL
LRSTPKPLSPAPPAKAPRPPTKPVAAPILAQDRVCPEITSPCPDLVRYSTLNSEHFPQPT
QQIKNIVRQYQQPPRGGQPEALRKDGGKVFVKRPDPHEEALRILKGHMSHAAVASGSQVP
REAVALVKPVTSTPRPSMGPTPVPPSRSLEPPEQTLQTQLHRLVNPNFYGYQDAPWRIFL
RKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRISEDERLKMKALFAQNQLDTQRPLA
TESVKRAVVSTARDSWEVYFSRLFPATGSVGTGVQVLAVSHTGIKLLRMVKGSREAGGRL
QVLRTYSFADILFVTIPSQNMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDSDYVV
AVRNFLPEDPALLAFHKGDIIHLQPLEPPRMGYSAGCVVRKKVVYLEELRHRGPDFGWRF
GTVHGRVGRFPSELVQPAAAPDFLQLPAEPGRGRAAAVAAAVASTAAAWEVGRRREGPPV
RAGSPDRAEDGLTLPPYSMLEFAQKYFRDPQRRPQDGLRLKSKDGRESRTLEDILCFTKT
PLQESLIELSDSSLNKMATDMFLAVMRFMGDAPLKGQSELDVLYTLLKLCGDHEVMRDEC
YCQVVKQITDNTSTKPDSCQRGWRLLYIVAAYHSCSEVLQSHLVRFLQDVSRTPGLPFQG
IAKACEQNLQKTLCFGVRVELPSSMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVAL
DVVEEICAEMALKRPEAFSEYVIFVVTNRGQHVCPLSRCTYILDVASEMEQVGGGYTLWF
RRVLWDQPLKFENELYVTMHYNQVLPDYLKGLFSSVPASRPSEQQLQQVSKLASLQHRAK
DRSYLPSVREVQDYIPAQLYRTMAGSAWLSLLGQHRQQTQALSPHQARAQFLGLISALPM
FGSSFFFVQSCSKATVPAPCILAVNQNGLNFLSIETHELMVKFPLKEIQSTRTQRPTASS
SYPYVEIALGDVAAQRTMQLQLEQGLELCRVVAVHVENLLSAREKRLTLPPSEITLL
Download sequence
Identical sequences G1LEH1
ENSAMEP00000005307 ENSAMEP00000005307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]