SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005319 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005319
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 6.64e-24
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 40-138
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-16
Family PDZ domain 0.031
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000543
Family Ubiquitin-related 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005319   Gene: ENSAMEG00000005024   Transcript: ENSAMET00000005540
Sequence length 1579
Comment pep:novel scaffold:ailMel1:GL192407.1:2974558:3024929:-1 gene:ENSAMEG00000005024 transcript:ENSAMET00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPPGIPIQTLTPVKHTVKI
EKDALLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAESLSCERAVNIL
REAEDSLSITVVRCSSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSMEYFALALEEQYNISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIISSKLNIMSTLAEFANISRVELTEESEKVSMVKVYLQDVKVLTLLLESNSAKD
LACLIAGYYRLFVDPDTSIFLWPGNKQQVHRVSAEEGYESRVCSDSEESSEVDCVLEPLS
DRHPLKLGPCRPLEKEEPPPGDSPTPEVARRGPSISGASSVTDSAESEASDSANTESRGC
RTSGSSESMDALEEDDLDTCSSSTSGFFHSSSLAFPETLGSNGQEERRRIETSGFLCLLD
LAQRANPLCQKTEFSESPTPETFSWGPELSAVRLDPRLYEGSQTDYYSLCSNISLASHLS
DSSESTASQQGRGLPAWGQQGWTEAQPSSTLEALAPHLPLALEDGSSDEEYYDAADKLTP
PGALSGPRAVPAAEPSATSLTNTVSTCTPENSLNPAPDGRDPSRRAGVKKYAKTLRKRRS
FLQTDYTCQVSFPLVPSASLESVDDLCYYNREPYLALGASSPTVSSLQDMQGEPGLLETK
ALGLLGPLRKTKSKNPASRVMEMEPETMETKSVIDSRVSSISAVRLRIDPNHKESSGDAP
LTATVASFPASTPHCSNPGSSGPDNAQEEPSQTLSPFQHLDGSAPKELTLELGDRTPSLS
NADPNPGRPCLPISPGPHSASQADTLELGGAQSETGLGSLFTNPVQETAPKYAEPSLPPP
VRSRSGECGINSGEKMASFPAEEEQQGQRSLGHDGEVTNKNGISLFHDESGQDSGDSEED
PSNAVGQTIGISAPAGGIIASLPLRPPVTGTEQTLPHSPTDPAKGQRETPSQACQAQEQK
LLEELDLDPDFLLGDQTIPSDFPLQGVKVEPLSHVTGEDTASRDPLQQISFNPGPSLPKP
LACPQKEPHLEGSNRCSLSENKGKVPSICLPAEKSFLCFAPESHPKVSANLRMATSLGFV
GANETVAPRIGMEQCSCQFSYATCFRSLQPDTEEEDRDLEAHPTAPLTSPPSAGSRLALP
WRPARAHSCSAEPLSRNSHIWPEYCSRALRQLKAAPAGSPEGFIQLTESLLELQDILETS
WGNGNRHPPEKCSWHFSESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVRDTFQHLVQ
LAGLCFQLTDCGRCSGRHREAAGNLRDVVYTYHQFVEAAKLTCERGYHDLSVKLLARQCT
ALTAAVFCLTQKFRASAAL
Download sequence
Identical sequences G1LEI3
ENSAMEP00000005319 ENSAMEP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]