SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005843 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005843
Domain Number 1 Region: 223-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.81e-88
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 525-770
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.04e-83
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 3 Region: 826-1042
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.25e-64
Family Eukaryotic proteases 0.00026
Further Details:      
 
Domain Number 4 Region: 64-133
Classification Level Classification E-value
Superfamily SEA domain 0.000000536
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 187-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000851
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005843   Gene: ENSAMEG00000005520   Transcript: ENSAMET00000006087
Sequence length 1043
Comment pep:novel scaffold:ailMel1:GL193358.1:498101:528070:1 gene:ENSAMEG00000005520 transcript:ENSAMET00000006087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTPSDLQPVPGAAKEVPALDATCCRVALSAVVATSIVMVTLGVLVASLSTQGVDVEHT
AELQGVQYARSLQQETSEYYGMLTPTLERLFVSSFQKTELEASCVGCTVLGYRAGNSSVF
VRFRLHFLLRALQSLSLGLEEELLQQGLRARLQGHGVPLAAHGTIVSAELTGSQKGPLTE
RDLKSGRCPGNTFSCRNSQCVTKVNPECDDRVDCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENNEHFCGAAVIGARWLVSAAHCFNGFQDPREWVAYAGTTFLSGA
EASTVRARVARITLHPRYNPDTADFDVAVLQLHSPLPFGRHVQPVCLPAATHVFPPRRKC
LISGWGYLREDFLVKPETLQKATVQLLDQGLCASLYGHSLTDRMLCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAITVASKPLAPTT
APTSAIPSIAWPTSPQSPVVHTPARPTQGPSTAPPDSVTASRPQECGARPAMEKPTRIVG
GLGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTASLTGI
GGTPVKMGLRRAVLHPQYDPGTLDFDVAVLELARPLSFSTNIQPVCLPLAIQKFPVGHKC
MISGWGSTQEGNATKPDILQRASVGIIDQKACSALYNFSLTDRMLCAGFLEGKVDSCQGD
SGGPLACEEAPSVFYLAGIVSWGVGCAQAGRPGVYTRITRLKGWILDTMSSGPLPSPPPP
RTAAGPTVPAVLASRATFRATSQPASRTAATASATVGGHTPLPSAPSPTVGFQPPDCGLA
PVAAMTRIVGGSAAGRGEWPWQEVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQ
WAAFLGTPFLSGAEGQLERVARIYKHPFYNPYTLDYDVALLAGPVRRSRLVRPICLPPRR
GPPCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGR
PHFPGVYTRVAAVRSWIGQNIQE
Download sequence
Identical sequences G1LG04
ENSAMEP00000005843 ENSAMEP00000005843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]