SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006023 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006023
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 519-630
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-16
Family Second domain of FERM 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000006023
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0641
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006023   Gene: ENSAMEG00000005677   Transcript: ENSAMET00000006272
Sequence length 736
Comment pep:novel scaffold:ailMel1:GL193273.1:224036:257317:1 gene:ENSAMEG00000005677 transcript:ENSAMET00000006272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEVTQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREAALFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLNRLLNERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEVDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences G1LGI3
ENSAMEP00000006023 XP_002925462.1.58354 XP_011230898.1.58354 XP_019661716.1.58354 XP_019661717.1.58354 ENSAMEP00000006023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]