SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006053 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006053
Domain Number 1 Region: 599-662,700-798
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-30
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 2 Region: 804-922
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 1216-1349
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000006053
Domain Number - Region: 27-120,705-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000418
Family BAR domain 0.07
Further Details:      
 
Domain Number - Region: 1118-1196
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000465
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 1350-1416
Classification Level Classification E-value
Superfamily PH domain-like 0.0209
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006053   Gene: ENSAMEG00000005683   Transcript: ENSAMET00000006303
Sequence length 1493
Comment pep:novel scaffold:ailMel1:GL192340.1:1149799:1245611:1 gene:ENSAMEG00000005683 transcript:ENSAMET00000006303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSETEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEEKLKAANIQTSESETRLYKKCQDLETLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTLKLNELELENQNLRLINQNQTEEIRNIQSKLQEAQGKKSSTISTP
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEEKDIEEMEIPEKSGEN
QIQENNQGQRMLHQTPCVSEQNRKTRPSFATDGGTSQNSGAPGSDWSSDEEDGSKGRSKC
RYTSTLSSHTSEEGVQCSRMGSEAYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KAQKCPLIKGNSESSKKEHDSSSDELNKKFQSQRLDYSSSSSETNTPSPILTPALTPKHP
NSLPGKGTQLVPSSNLLPPKLRIPNVFSISVALAKRHVSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDDDSTEILENMDTSCDDGLFSYDSLESPCSDDQEPCDSAKKPACGKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENVNKNSVALLSYTTSGLYTSLIYKNITTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDTRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTESSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKTW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCGILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQAANPLFLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQVCLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPTQSGFALFTDDPSGRDVEHCLQGNIKICDIISKWEQASKEQ
QPGKWEGTRTVRLTYKNRLYFSMQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLAQVEIGDFERPFSTPAGHVTNQCKTNQTLKQVIEKFYPKRYRDDSSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPVTPSALGSTSMWLAIHEDGLSI
LEYNSMRLIVSYVYKNLMTFGGHQDDFMIVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKATFHHLSAPALLSAQTRGPEARAVGSQPLLLSSRPTKGPTLL
Download sequence
Identical sequences D2GU90
ENSAMEP00000006053 XP_002912446.1.58354 ENSAMEP00000006053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]