SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006162 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006162
Domain Number 1 Region: 112-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000169
Family V set domains (antibody variable domain-like) 0.097
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000006162
Domain Number - Region: 28-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00277
Family I set domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006162   Gene: ENSAMEG00000005846   Transcript: ENSAMET00000006416
Sequence length 258
Comment pep:novel scaffold:ailMel1:GL192688.1:719436:732129:-1 gene:ENSAMEG00000005846 transcript:ENSAMET00000006416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLMALYQNFKFSEKNVALIEHSSVPVEKNITLERPSDIELTCQFTTSGNVNSINPTWKKG
DEQLKGYRVTATGNILYTQYRFIIDSNKQMGSYSCFFEEEKKQRGTFNFRVPEVQGKNKP
LITYVGDSTVLICKCQHCSPLNWTWYSSNESVQVPVDVRMNDKYAINGTNANETRLRIMQ
LSEADKGSYWCHAVFELGESQERVELVVLSYLVPLKPFLGIVAEVVLLVSVILFCEMYTQ
KKKMHTDDGKEFEQAVQL
Download sequence
Identical sequences G1LGX1
ENSAMEP00000006162 ENSAMEP00000006162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]