SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006495 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006495
Domain Number 1 Region: 70-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006495   Gene: ENSAMEG00000006170   Transcript: ENSAMET00000006765
Sequence length 135
Comment pep:novel scaffold:ailMel1:GL192397.1:1618896:1645542:1 gene:ENSAMEG00000006170 transcript:ENSAMET00000006765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFP
APFCRAEGACGGTLRGTSSTISSPHFPSEYGNNADCTWTILAEPGDTIALVFTDFQLEEG
YDFLEISGTEAPSIW
Download sequence
Identical sequences G1LHU7
ENSAMEP00000006495 ENSAMEP00000006495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]