SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007510 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007510
Domain Number 1 Region: 424-680
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-60
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1338-1595
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-57
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 3 Region: 726-982
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000149
Further Details:      
 
Domain Number 4 Region: 1033-1286
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-47
Family YWTD domain 0.00000315
Further Details:      
 
Domain Number 5 Region: 386-417,684-719,977-1028
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 247-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 211-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 49-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 126-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 10 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1292-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000986
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 12 Region: 87-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 170-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 341-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 9-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000007510
Domain Number - Region: 1595-1632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007510   Gene: ENSAMEG00000007069   Transcript: ENSAMET00000007825
Sequence length 1888
Comment pep:novel scaffold:ailMel1:GL192844.1:619876:653344:-1 gene:ENSAMEG00000007069 transcript:ENSAMET00000007825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFH
CDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDGDNDCGD
NSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPPCNLEEFQ
CAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCD
DQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQF
LCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGVVQ
CTCHTGYRLTEDGHMCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDRRSCKALG
PEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANL
NGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPR
AIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGHRMYWVDA
KHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEII
RNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHACA
QSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTI
SRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWEN
LDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRL
YWADAGMKTIEFACLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGL
DRETLQENLENLMDIHVFHRRRPPVSTPCARENGGCSHLCLRSPNPSGFSCTCPTGINLM
PDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYW
SDSTLHSISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSM
RKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLISNNLGWPNGLT
VDKASSQLLWADAHTERIEAADLNGASRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHR
ADKGTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCSCPT
GIQLKRDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHIPVPELNNVISLDYDSVDG
KVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRL
DGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWP
NGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQALVSHVSHPFALTQQDRWIYWTDWQTK
SIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVC
ACPDEPDGRPCSLVPGLVPPVPRATSLSGKSPVLPNTLPTTLRSSTTRTRTSLEEVEGRC
SEKDAQLGLCAHSNEAIPAAPGEGLHVSYVIGGLLSILLILVVIAALMLYRHKKSKLTDP
GMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGSDHNYTKEKIKIVEGICLLS
GDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVH
TAATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences D2HHJ3
ENSAMEP00000007510 ENSAMEP00000007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]