SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007681 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007681
Domain Number 1 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-18
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 2 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 35-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000085
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 5 Region: 329-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000707
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000007681
Domain Number - Region: 356-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00105
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007681   Gene: ENSAMEG00000007296   Transcript: ENSAMET00000008002
Sequence length 714
Comment pep:novel scaffold:ailMel1:GL193372.1:381939:386055:1 gene:ENSAMEG00000007296 transcript:ENSAMET00000008002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFTPLPFLALLLGGALAHPDRTFFPHPACEDPPAVLLEVQGTLQRPLGQDSRSAPSNCTW
LILGSKEQTVTVRFQKLHLACGSERLVLRSPLQPQISLCEAPASPLQLPGGNVTITYSYA
GARAPVGQGFLLSYSQDWLMCLPEEFQCLNHRCVPVAQHCDGIDACGDGSDEAGCSSDPF
PDLTPAPVPTPPCNHTLEDFYGVFSSPGYAHPASVSHPQSCLWLLDPHDGRRLAVRFTAL
DLGYGDAVHVYDGPGPPKTSRLLRSLTHFSNGKAVTVETLSGQAIVAYHTVAWSSGRGFN
ATYHVRGYCLPWDRPCGLGAGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPSCPPG
HFPCGPAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCD
GQPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAP
LSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPG
AASGARRRQRGRSVRRLVRRLRRWGLLPRANPPARTPETRSQVTPSAAPLEALDGSTGPA
REGGAVGGQDGEQAPPLPTKAPLPSSSASPAPPTVSEAPGPLPSAPLEPSLLSGVVQALR
GRLLPSLRPPGPTRTPPEPHTPVLSPEDEDDVLLLPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences G1LL59
ENSAMEP00000007681 ENSAMEP00000007681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]