SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008193 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008193
Domain Number 1 Region: 394-537
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 290-395
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-35
Family Second domain of FERM 0.00000416
Further Details:      
 
Domain Number 3 Region: 210-289
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008193   Gene: ENSAMEG00000007667   Transcript: ENSAMET00000008534
Sequence length 989
Comment pep:novel scaffold:ailMel1:GL193025.1:241576:336308:1 gene:ENSAMEG00000007667 transcript:ENSAMET00000008534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKESEPLGADATKEKPKEVAENQQNQSSDPEEEKGSQSSPTAESQSSPR
RQKRDKDPSESRGISRFIPPWLKKQKSYTLVAAKDGGDKKEPAQAVVEEVLDKEESLPEG
DGQAKGDAGETALRKQQEMKVDVKEEKPSVSRPEAQPAEEVGKEREEKVKEMQEDKSEEA
AKRETKEVQTNELKAERALQKAGKKTKAVQCKVILLDGTEYSCDLEKRAKGQVLFDKVCE
HLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDLT
RYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSSDLSDFQFAPTQTK
ELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLL
IYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCV
EHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSR
SLDGAPVGVVDESLRKDFPGPAGEISAYGPEVVSTAMVQDGDGRRDLRSPAKAPHVQFIE
GKKNSLRVEGDNIYVRHSNLMLEDLDKAQEDILRHQASISELKRNFMESTPEPRPNEWEK
RRITPLSLQTQGSSHETLNVVEEKKQAEVGKDERVITEEMNGKELSPGSGPGEMRKAEPL
TQKDSTSLSSESSSSSESEEEDAGEYRPHHRGTEGTIREEQEEEEAGRAAKVVEREHPVP
GASPGRQAGASVSTVETEIQENVVAPKIPAEKSVNEGAIKQDMSEETEDEQHKVNGEVSH
VDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGA
GGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQA
IREAREQHPDMSVTRVVVHKETELEEGEE
Download sequence
Identical sequences D2HLW8
ENSAMEP00000008193 ENSAMEP00000008208 XP_019659460.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]