SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008236 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008236
Domain Number 1 Region: 151-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-33
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 307-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-31
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 3 Region: 470-582
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.15e-27
Family Frizzled cysteine-rich domain 0.00029
Further Details:      
 
Domain Number 4 Region: 265-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000008236
Domain Number - Region: 431-459
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000707
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008236   Gene: ENSAMEG00000007827   Transcript: ENSAMET00000008579
Sequence length 585
Comment pep:novel scaffold:ailMel1:GL192378.1:529582:534354:1 gene:ENSAMEG00000007827 transcript:ENSAMET00000008579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKECSDIILCVEATELSKTEFCNPAFEPESGPPCPPAAFREDASCSIPAPWHGQRPRGLR
PDCHFSWLCVLLLAGLLLLLLGLLVAIILARESRALLGRRAFLPTQDLTPSGTTTTTPTT
PSNITTTSPASGNPKEQLEEAGMSPSPQPTCGGLLSGPRGFFSSPNYPDPYPPNAHCVWH
IQVAADRAVQLRIEALSMESVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASRLRV
AFVSDSSVEGFGFHAWYQAVTPGNGSCAHDEFPCDQLVCLLPDSVCDGIANCADGSDETS
CSAKFLGCGGNLTGLQGTFSAPRDLQRYPRQQLCTWHISVPTGHGLELRFHNFSLEAQDE
CKLDYVAVYEASDAGALGLLGRFCGTDPPPRLISSHQQLVVFFRTDRGISTGGFSATYRA
LNATESGCPWREFCRDGGCKSPQWTCDTWRRCPDSSDDSCSSPLFPPPELACEPVQVEMC
VGLSYNTTAFPNVWVGMATQEEVVEILRGYKSLTSLPCYQSFRRLLCGLLVPHCTPIGSV
LPPCRSVCQEAERQCQSGLALLGTPWPFNCNRLPEAAGLEACARP
Download sequence
Identical sequences G1LMJ5
ENSAMEP00000008236 ENSAMEP00000008236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]