SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008540 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008540
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 503-596
Classification Level Classification E-value
Superfamily Moesin tail domain 2.35e-25
Family Moesin tail domain 0.0018
Further Details:      
 
Domain Number 4 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008540   Gene: ENSAMEG00000008080   Transcript: ENSAMET00000008899
Sequence length 596
Comment pep:novel scaffold:ailMel1:GL192437.1:2000335:2074504:-1 gene:ENSAMEG00000008080 transcript:ENSAMET00000008899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEITTKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGTSSKHNTIKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences G1LNB4
ENSAMEP00000008540 ENSAMEP00000008540 XP_002915626.1.58354 XP_004766524.1.14098 XP_011371654.1.92234 XP_016019808.1.101085 XP_021559289.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]