SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008602 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008602
Domain Number 1 Region: 355-419,461-559
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-31
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 2 Region: 567-688
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 979-1111
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-18
Family Second domain of FERM 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000008602
Domain Number - Region: 880-957
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000122
Family Ubiquitin-related 0.054
Further Details:      
 
Domain Number - Region: 1114-1175
Classification Level Classification E-value
Superfamily PH domain-like 0.000615
Family Third domain of FERM 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008602   Gene: ENSAMEG00000008171   Transcript: ENSAMET00000008965
Sequence length 1250
Comment pep:novel scaffold:ailMel1:GL193220.1:134453:158572:-1 gene:ENSAMEG00000008171 transcript:ENSAMET00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKQMRAEEAKGVQEKAAKIKEWVTLKLAELEMENQHLKSSNEQLVEQVGALQDALAALQM
APSGKLLMNPQEAPEQDSAPLGSGTQPIGQDSGPHAQGALKAAMPSPSLGALQSKDSGPK
AGLSLEESSSIVVHPGERVEAKTLPPPLRREGSPRRPCMKLSIHRHGSASWGEGLVTAQG
GALPGTKNSAREGSPGCSLTLPKVRVPSTPRDSIQLAKRHHSQPQVGPGCFNHVVSIEMG
TLSALHPSSLPEAEARAGPREAPESMEVEEPPPAGKKEERESPKARRAEWEEVELGSKPP
TPPLHRFPSWESRIYAVATAGMRLSDASPRTNAACCASSPPALASPGLVYKNVTVPVYTA
LKGRATQISTVPFVDESSGSDDDCSSQASFRTSVPCCEPRKTSGLGSPRAIKRAGVSMSS
LSSEGDYAIPPDACSLDGDYSEPEHKLQRTSAFSGEGPGLGGESLEKSGYLLKMGSRVKT
WKRRWFVLRQGQIMYYKSPSDVIRKPQGQVELNSCCQIVQGEGAQTFQLISEKKTYYLTA
DSPGLLEEWVRVLQSLLKVQAVGPPALPRGGTKPAVKGWLTKVKHGHSKLVWCALVGRTF
YYYRSHEDKRPLGHLPVRDARIEEVDRSCDSDEDYEAGGSRRLLSSHCTLVIHPPEHSPT
YLLIGTKHEKDTWLYHLTVAAGDSSARVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSK
DGLYTSLTTLPSEALQTEAVKLFKSCQLFINVPVEAASVDYHVSLAQAALQVCLAHPELQ
SEIYCQLMKQTSCRPPQKCSLVQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRNETG
QYATYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSSPFSIPVHFTNGSYQVVGFD
GSSTVDEFLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLQGSIKICDAISKWEQALK
ELHSGKAEGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELAL
EMAALMAQVEYGDLERPSPPGPGSTTPAKVQHHLQQVLDRFYPRRYRHGAPPEQLRHLAD
LLTTKWTALQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQMSSKESTLVWIAVNEDGV
SILDHNTMQVHVTYPYSSVMTFGGCWDDFMLVIRSIPDQSSGKGHIEKLLFRMAAPKIAE
ATFIMASYMNHCSTTVNPPTNPPAAHRLWELDGQKFFASVPCAARGPTLL
Download sequence
Identical sequences G1LNH4
ENSAMEP00000008602 ENSAMEP00000008602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]