SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009739 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009739
Domain Number 1 Region: 37-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.46e-279
Family Motor proteins 0.000000000119
Further Details:      
 
Domain Number 2 Region: 1989-2105
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1247-1350
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2106-2196
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1889-1997
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000022
Family First domain of FERM 0.069
Further Details:      
 
Domain Number 6 Region: 1342-1436
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000101
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 7 Region: 1601-1671
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000159
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000009739
Domain Number - Region: 790-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000189
Family Motor proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009739   Gene: ENSAMEG00000009185   Transcript: ENSAMET00000010163
Sequence length 2210
Comment pep:novel scaffold:ailMel1:GL194300.1:202444:266788:1 gene:ENSAMEG00000009185 transcript:ENSAMET00000010163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDYVWMDLRSGQEFDVPIGAVVKLCDSGQVQVVDDEGNEHWISPQNATHIKPMHPTSVH
GVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNK
KIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAVSGQHSWI
EQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQ
APDERNYHVFYCMLEGMSVGQKKKLGLGQATDYNYLAMGNCITCEGREDSQEYANIRSAM
KVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPD
LMNCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQE
VKSSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIGWL
HIEFTDNQDALDMIASKPMNIISLLDEESKFPKGTDTTMLHKLNSQHKLNSNYIPPKNNH
ETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRK
RSPTLSSQFKRSLELLRRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETI
RIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQDDLRGTCQRLAEAVLGTHDDWQIGKTK
IFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRR
NYELMRLGFLRLQALHRARKLHQQYRLARRRIIEFQARCRAYLVRKAFRHRLWAVLTVQA
YARGMIARRLHRRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLA
REDAERELKEKEEARRKKELLEQMERARHEPINHSDMVDKMFGFLGTSGSLPGQEGQAPS
GFEDLERGRRDMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRRPLKQP
LLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKR
ELQALQGEGEAQLPEGQRKSSMRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNSMLED
RPTSNLEKLHFVIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPS
EKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFM
DGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQ
CEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSDDNVATNLIYQQVVRGVKFGEYKCEKE
DDLAELASQQYFVDYGSEMVLERLLSLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYA
QRRTDAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQE
QVLLELSFPELTAVSSSRECRVLLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSSRGAKL
VAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFL
SFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPPREIVALVT
MTPDQRQDVIRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLW
SHTREPLKQALLKKILGSEELSQEACMAFIAMLKYMGDYPSKRTRSVNELTDQIFEGALK
AEPLKDEVYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSSVLLPHVQRFLQSRKHCP
LALDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAK
DFCRGIAARLLLKSAEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPVKDGIVP
SLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVK
FEEDKSYFPSIPKLLRELVPQDLIRQISPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIF
KWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNT
YFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences G1LRQ2
ENSAMEP00000009739 ENSAMEP00000009739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]