SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009916 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009916
Domain Number 1 Region: 195-340
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-45
Family Third domain of FERM 0.000000274
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-38
Family Second domain of FERM 0.000000735
Further Details:      
 
Domain Number 3 Region: 491-579
Classification Level Classification E-value
Superfamily Moesin tail domain 2.88e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-26
Family First domain of FERM 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009916   Gene: ENSAMEG00000009395   Transcript: ENSAMET00000010350
Sequence length 579
Comment pep:novel scaffold:ailMel1:GL192417.1:287941:312944:1 gene:ENSAMEG00000009395 transcript:ENSAMET00000010350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLKLDKK
VSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPETAVL
LGSYAVQAKFGDYNKDTHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLK
DSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKEDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKTKKAEKE
LSDQIQRALQLEEERKRAQEEAERLENDRVAALRAKEELERQAADQIKSQEQLAAELAEY
TAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMPPPPPPVYEPVSYHVQD
NLQDEGTEYTGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLMTLTNELSQARDENKR
THNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences G1LS78
ENSAMEP00000009916 ENSAMEP00000009916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]