SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010033 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010033
Domain Number 1 Region: 289-401
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000968
Family Second domain of FERM 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000010033
Domain Number - Region: 64-168,225-264
Classification Level Classification E-value
Superfamily ARM repeat 0.00104
Family MIF4G domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010033   Gene: ENSAMEG00000009543   Transcript: ENSAMET00000010470
Sequence length 498
Comment pep:novel scaffold:ailMel1:GL192703.1:806594:811472:1 gene:ENSAMEG00000009543 transcript:ENSAMET00000010470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAHSDDSVAYISLSTDSHDYTMQEFALYHFRKPQTLLDHTGRDAKEKAMASLVQYTKAPI
QESLLRLSEEDANTQAVESFQVLMQFMGDQSKPRGKDEMELLYDLLRLCREKENLRDEIY
CQVIKQVTGHPQPEHCARGWNFLSLLTGFFPPSATLMPYVAKFLQDSGPSQELAQSSQEH
LQRTVKYGGRLRLPSPGETQALLKGQGVRSLLIHLPGGMDYKTNIRTFTVAAEVLEEVCQ
QMGIMDPQEVQEFALFLIKREGELVRPLWPHEYLNSVLDQDISLHSRRLSWETPLHFDNP
TYITTHYLQVLRDYLQGKLLVSPKASAQLARLAALQHRSKAQEDHLLERDLWTYLPKPVQ
SQVNMSAIRNLTDQELRQLPVCSPQEAQISFLEAVSQLPLFGYTVYVVLRVSQLALSGPS
LLGLNRQHLILMDPCSQKRCHSITLKDLHRLHLLSPLESKGPPGLELNYGSAESPQTIWF
ELPKAQELKDTIAFLLDS
Download sequence
Identical sequences G1LSJ3
ENSAMEP00000010033 ENSAMEP00000010033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]