SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010216 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010216
Domain Number 1 Region: 56-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 145-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 3 Region: 107-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010216   Gene: ENSAMEG00000009731   Transcript: ENSAMET00000010663
Sequence length 188
Comment pep:novel scaffold:ailMel1:GL192442.1:2056941:2062294:-1 gene:ENSAMEG00000009731 transcript:ENSAMET00000010663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTPHVGCGPLCCSRQGACLLAFLLLLLVTFAALITLVAILGLPPRTPGAQTCVTATNRT
GFLCHDRRACIPASRVCDGVRTCAHGEDEDEAMCRDMPQNLPSFLVARCGDPSSWIYSDQ
KCDGANNCGDCSDELSPAAVTACPPCGPGWWPCPSTVFGYCGCIPRSLCRDHTQHCSDWS
DEYSCPGP
Download sequence
Identical sequences G1LT20
ENSAMEP00000010216 ENSAMEP00000010216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]