SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010226 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010226
Domain Number 1 Region: 512-665
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.32e-67
Family A middle domain of Talin 1 0.000000071
Further Details:      
 
Domain Number 2 Region: 765-900
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.29e-53
Family I/LWEQ domain 0.000000231
Further Details:      
 
Domain Number 3 Region: 2307-2498
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 670-794
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.11e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 5 Region: 1853-1985
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2e-46
Family VBS domain 0.000000445
Further Details:      
 
Domain Number 6 Region: 1237-1373
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.51e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 207-320
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 8 Region: 1087-1219
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.04e-27
Family VBS domain 0.029
Further Details:      
 
Domain Number 9 Region: 321-411
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 10 Region: 1422-1567
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000102
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 91-148
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000183
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1707-1826
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000298
Family VBS domain 0.023
Further Details:      
 
Domain Number 13 Region: 2022-2144
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000010226
Domain Number - Region: 961-1054
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000687
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1610-1670
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00309
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 2112-2239
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0497
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010226   Gene: ENSAMEG00000009574   Transcript: ENSAMET00000010673
Sequence length 2553
Comment pep:novel scaffold:ailMel1:GL192634.1:228017:252816:-1 gene:ENSAMEG00000009574 transcript:ENSAMET00000010673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVEPGWRGEAATMVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFG
LFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTV
TDMLMTICARIGITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTD
DELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSH
PVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQ
MSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVI
QEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDH
FGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSM
PPAQQQITSGQMHRGHMPPLLLLPLSIPYFSNPSMQAVQAAQATLDDFDTLPPLGQDAAS
KAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMS
RGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQAS
GELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQ
CALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVG
AAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARI
LAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQ
RLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAAKASAGP
QPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASV
PTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVK
AAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGL
RSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQV
AKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAG
LNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGI
SMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALR
ELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIAT
ASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQ
AQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDG
AFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLE
SAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECEAAITAL
NSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLG
HKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQ
AAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEG
SFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAE
NEEIGAHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAAL
QAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVE
DTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVA
KALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEA
TTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLS
RRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQ
LTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKP
RAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQ
WSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQ
DSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEM
LRKERELEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences G1LT30
ENSAMEP00000010226 ENSAMEP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]