SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010263 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010263
Domain Number 1 Region: 767-1044
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-72
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 448-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.93e-49
Family Protein kinases, catalytic subunit 0.0000648
Further Details:      
 
Domain Number 3 Region: 296-425
Classification Level Classification E-value
Superfamily SH2 domain 6.36e-18
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 204-311
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 66-186
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000162
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010263   Gene: ENSAMEG00000009661   Transcript: ENSAMET00000010711
Sequence length 1057
Comment pep:novel scaffold:ailMel1:GL193058.1:2562:72801:1 gene:ENSAMEG00000009661 transcript:ENSAMET00000010711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITPVYHSMFALMSETERIWYPPNHVFHIDESTRQNVLYRIRFYFPYWYCNGSNRTYRHG
ISRGAEAPLLDDFVMAYLFAQWRHDFLHGWIKIPVTHETQEECLGMAVLDMMRLAKEKDQ
TPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQFSHCKATARNLKLKYL
INLETLQSAFYTEQFEVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQ
LYCDFPDIIDVTIKQASQEGSNESRIVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRL
TADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQTGLYVLRCSPKDFNKY
FLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNCYQMETVRSDSIIFQF
TKCCPPKLKDKSNLLVFRTNGISDVPTSPTLQRHNNVNQMVFHKIRNEDLMFNESLGQGT
FTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGV
CVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMHFLEEKALIHGNVC
AKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATD
KWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELANLINNCMDYEPDFR
PSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQL
GKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKG
VCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHR
DLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVAS
DVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCP
DEIYLIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences D2HMR9
ENSAMEP00000010263 ENSAMEP00000010263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]