SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010323 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010323
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-26
Family SH2 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000523
Family SOCS box-like 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010323   Gene: ENSAMEG00000009824   Transcript: ENSAMET00000010773
Sequence length 198
Comment pep:novel scaffold:ailMel1:GL192861.1:766631:768934:-1 gene:ENSAMEG00000009824 transcript:ENSAMET00000010773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGAEGTQSQWGTAGSAEEPSPEAACLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEGYKFQV
Download sequence
Identical sequences D2HHX8
ENSAMEP00000010323 XP_011226466.1.58354 XP_011226467.1.58354 XP_019657900.1.58354 ENSAMEP00000010323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]