SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010549 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010549
Domain Number 1 Region: 280-422
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 176-281
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 96-175
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010549   Gene: ENSAMEG00000010011   Transcript: ENSAMET00000011006
Sequence length 878
Comment pep:novel scaffold:ailMel1:GL192479.1:2043191:2087835:1 gene:ENSAMEG00000010011 transcript:ENSAMET00000011006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAGPVTPAGHGGHPEANSNEKHPPQQDTRPADQSLD
MEEKGYGEADGLSERTTPSRAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVL
FDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQ
LTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRF
APNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGV
CANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKR
LWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSS
KRYTMSRSLDGAEFSRPASVSENHDTGPDGDKQEEDGESGGRRSEAEEGEVRTPTKIKEL
KLEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSP
ASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDAVFLKDNHLAIE
RKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSETEGLVFSRDLN
KGGLGQEDESGGIDDSPDRGACATPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVS
TMDSSQVDGTAPGGKESITTAPSITTETISTTMENSLKSGKGAAAMIPGPQTVATDIRSL
SPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALA
LAIKEAKLQHPDMLVTKAVVYRETDPSPEERDRKPQVS
Download sequence
Identical sequences G1LU01
ENSAMEP00000010549 ENSAMEP00000010549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]