SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011312 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011312
Domain Number 1 Region: 3170-3434
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.0000027
Further Details:      
 
Domain Number 2 Region: 1409-1671
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-45
Family YWTD domain 0.0000064
Further Details:      
 
Domain Number 3 Region: 2359-2602
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-43
Family YWTD domain 0.0000115
Further Details:      
 
Domain Number 4 Region: 683-942
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-42
Family YWTD domain 0.0000199
Further Details:      
 
Domain Number 5 Region: 370-629
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-41
Family YWTD domain 0.00000875
Further Details:      
 
Domain Number 6 Region: 4024-4295
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-38
Family YWTD domain 0.0000352
Further Details:      
 
Domain Number 7 Region: 1726-1984
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-36
Family YWTD domain 0.0000851
Further Details:      
 
Domain Number 8 Region: 2034-2305
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-36
Family YWTD domain 0.0000423
Further Details:      
 
Domain Number 9 Region: 239-255,290-359,622-678
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1310-1400,1671-1717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 2706-2747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 1237-1278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 13 Region: 1119-1156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000733
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 14 Region: 3687-3724
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 15 Region: 1078-1116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1038-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3001-3040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 18 Region: 3116-3163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000153
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 19 Region: 3762-3802
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2828-2867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 21 Region: 3556-3596
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 22 Region: 2956-2998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 23 Region: 3597-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 24 Region: 2-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 25 Region: 3722-3762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 994-1032
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 76-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3481-3515
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 29 Region: 156-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 3517-3559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 31 Region: 3040-3080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 3895-3931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 190-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 2669-2707
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 35 Region: 2875-2911
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 36 Region: 3809-3845
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 37 Region: 1201-1236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 38 Region: 40-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 39 Region: 1157-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 3851-3889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 41 Region: 1989-2037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.02
Further Details:      
 
Domain Number 42 Region: 2915-2958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 43 Region: 2792-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 44 Region: 3650-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 45 Region: 3081-3127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000321
Family EGF-type module 0.011
Further Details:      
 
Domain Number 46 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 47 Region: 120-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 48 Region: 3976-4011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000914
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 49 Region: 2751-2788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 50 Region: 3938-3976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000664
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011312
Domain Number - Region: 4348-4381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 2311-2357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000534
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 951-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00542
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 3438-3470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 2626-2667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0399
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 4296-4380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0722
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011312   Gene: ENSAMEG00000010654   Transcript: ENSAMET00000011794
Sequence length 4621
Comment pep:novel scaffold:ailMel1:GL192485.1:1229479:1388991:1 gene:ENSAMEG00000010654 transcript:ENSAMET00000011794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECGSEHFRCEDGQCISASWRCDGTRDCLDDSDEFGCPSPSCKSDQFLCQGEGLCIPNFWE
CDGDLDCEDGSDEHRHCAGRTCSSHQITCSSGECIPNEYRCDHVRDCLDGTDEKDCQYPT
CEQLTCASGACYNSSQKCDGKVDCRDFSDENNCTKVCLQHEFQCDGGVCLPHAYVCDHFP
DCEDGSDEHSCTYETCRGNQFTCHSGYCISQDSVCDGENDCKDNSDENGCESSSHHIREC
YPGEWACPESGKCIPIGNVCDGTIDCPGGEDENNSTKGRYCDVNLCSLLSCEYQCHMSPN
GGMCYCPPGFIVDQNNTRNCVDFNDCQIWGVCDQICEDRIGHHQCHCAEGYVLEHQRHCK
ADISSEQASVIFSNGRDLLIGDIHGWTFSMLVRSQNHGMAVGVDFHYHLHRVFWTDTVQD
KVFSVDIDGLNIQEVVSLDDPENVAVDWVNNKLYLVETKINCIDMVNLDGSHRVILITEN
LGHPRGIALDPTVGYLFFSDWESLSGEPKVERAFMDGTNRKDLVKTKLGWPAGITLDIVS
KRVYWVDCRFDYIETVTYDGIQRKTVVQGGSLVPHPFGISLFEDHVFFTDWTKMAVMKAN
KFTEPSPQEYHQTSLRPFGVTVYHSLRQPYVSNPCGDNNGGCEHVCVLSHRTDNDGLGYR
CRCTLGFSLDVDNRHCVAVKQFLIFSSEVAVRGIPFNLSTQEDVIVPVTGSPSFFIGIDF
DAQEKTIFFSDTAKDMIYKQNINGTGREILTANRVESVESLTFDWISKNLYWTDASYRSV
SVMRLADKSRRAIIQKLNNPRSIVVHPIAGYIFFTDWLHPAKIMRAWSDGSNLLPIVNTT
LGWPNGLAIDWGALRLYWVDAFFDKIEHSTFDGLDRRNLGHIQQMTHPFGLTVFEDHVFF
TDWRLGAIVRVRKTDGGDMRVIRSGITNIMHVKSYDANTQIGSNYCNRPTHPNGDCSHFC
FPVPNFQRVCGCPYGMSLTSNHLTCQEDPSREPPVQQCGSFSFPCSNGRCVPSSYRCDGV
DDCQDNSDEHLCGEFNNTCAPSAFTCGHGECIPAHWKCDKQYDCVDGSDEQNCPSQAPTS
CPASLFACDNHMCIPRSWLCDTDNDCADGSDEKNCQFTETCLPSQFRCPDHRCIDLSFVC
DGDKDCVDGSDEAGCVINCTAFQFKCASEDRCISNRYHCDGVSDCSDHSDEIDCSTRPPG
MCHPDEFQCQADGVCIPKSWECDGHSDCVFGSDEHHGCAPRTCPPSRFLCDNGNCIQRDW
LCDGDNDCRDMSDEKDCPTQAFHCPSWQWHCPGYSICVNLSAVCDGIFDCPNGTDESPLC
NQDSCSDFNGGCTHQCVQGPFGAQCLCPSGYLLANDSKTCEDIDECNVPGFCSQHCFNMR
GSFRCWCDEEYTLDTDGRTCKVTGSESLLLLVASQNQILADNITSQFHNIYSIVQNGSHI
VALDFDSISGRVFWSDGSQGKIWSAFQNGTDRRVIQNSGVTMTESIVVDWVGRNLYWTDY
SLETIEVSKLDGSHRTVLISRNVSNPRGLALDPRISDHLMFWSDWGHHPRIERASMDGSL
RTVIVEDKIFWPSGITIDYPNRLLYFIDSYLDYIDYCDYNGQHRKQVIASDLILRHPYAL
TLFEDSVYWTDHSTYQVVQANKWHGGNQSVIIRNIQQPLGVVAVHPVKQPNGENSCAASS
CSHLCLLSSQRPHLYSCVCPSGWSLSHDSVTCLKDDQPFLITIRYSIIFGISLNPEVKSN
DAMVPIAAVMNGYDVEFDDSEQFIYWVENPGEIHRVKTDGTNRTVLASLTSSGSSMSLAL
DWISKNLYYTDPETPSIEVLKLQGDVRYRKTLITSDGTALGVGSPVGITVDPVNGKLYWS
DQGTDSGIPAKIASANMDGTFPKVLFTGNLEHLEFITLDIEEQKLYWAVTSTGVIERGNV
DGTNRMILVNHLSHPWGIAVYDSFLYYIDEHYEVIERVDKATGANKVVLRENIPNLRGLR
VYHRRDASSNGCSNNANACQQICLPIPGGLFSCACASGLKLNPDNRTCSPYSSFLIVSML
SIIRGFSLDFSDHSEAMVPVAGEGRNALHVDVDVSSGFIYWCDFSSSVTSQNAIRRIKPN
GSGFMNIVTDGIGENGVRGIAVDWVAGNLYFTNAFMSETLIEVLRINTTYRRILLKTTAD
RPRDIVVDPKNRYLFWADYGQNPKIERSFLDCTNRTVLVSEGIVTPRGLAVDHSNGYIYW
VDDSLDIIARIGIEAEESEIIGYGNRYPTPYAITVFGNSIIWVDRNLKKIFQASKEPENT
EPPTVIRDNLNWLRDVTVFDQSVQPRSPAEVNHNPCLENNGGCTHFCFALPGLDTPKCGC
AFGTLEGDGKNCAIQTENFLIFALENNLRSLHLDPEAHSPPFEAISVDRVAVDLVYDGLN
NRIYFTQSLASGNGQILYVNLNSQTRSPTAIISGRGNPDGIAFDWINRRIYYSDYINQTI
NSMAEDGSQRTVIAHVSKPRAIVLDPCRGYMYWTDWGTNAKIERATLGGNFRIPIVNSSL
VWPNGLTLDHENDLLYWADASLQKIERSTLTGTQREVIVNTVFHPFSLTLYGQYIYWTDW
NTQKIYRANKYDGSGQMALTMSLPFRPNGIRVAIEYHHQPQCSNPCSEFNGGCSHICAPG
PRGAECQCPHEGHWYLANNKKHCIVDNGTRCDSSKFTCLNGHCISEQWKCDNDNDCGDGS
DELEGVCAFHTCHPTAFTCANGRCVQYHYRCDHYNDCGDNSDEVGCLFRDCNATVEFTCG
NGKCIPLQFVCNGINNCRDNDTSDEKNCSDRPCHPGYVKCQTTNICIPHFYLCDEDNDCG
DMSDESPLFCASHTCSSDEFPCTSGRCIPRHWYCDEEGDCPDGSDEPATCEYLEATCLSN
EFKCDSGRCIREEWICDGDNDCGDMSDEDERHHCDSHNCSSSEFLCVNNVPPSRKCIPQS
WVCDGDADCTDGYDEHQNCTRRSCSGNDFTCNNGLCVPHSYRCDRRNDCGDYSDERDCSY
PPCSENQFTCQNGLCIYKQYMCDGENDCRDGSDELEHLCHTPETTCPPHQFRCDNGNCIN
MGEVCNRLNDCLDNSDEKGCGVNECNDPRLSGCDQNCTDTLTSFYCSCRPGYKLMSDKRS
CDDIDECKETPFVCSQKCENVMGSYICKCAPGYIREPDGKSCRQNSNIDPYLIFSNRYYL
RNLTTDGHFYSLILQGLGNAVALDFDRVEKRLYWIDTENKVIERMFLNKTNRETVINYKL
PAAESLAVDWVARKLYWVDAYLNCLSVSDLDGRYRRKLAEHCVDDNYTFCFDHPRGIALH
PQYGHVYWADWAHRAYIGRVGMDGTNKSVIISTKIEWPNGITIDYTNDLLYWADAHLGYI
EYSDLEGHHRHTVYDRTLPHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSDRVVLVNTTH
KPYDIHVYHPYRQPIVNNPCGTNNGGCSHLCLIRAGGNGFTCECPDDFQTLRLGATKVCL
PRCSSTQFLCANSEKCIPIWWKCDGQRDCSDGSDEPVLCPQRYCRLGQFQCKDGNCTSSH
FLCNAHQDCPDGSDEDHILCEHHRCESNEWQCANKRCIPEAWRCDSENDCGDNSDEDVYN
CASRMCQPGYFKCANNHCIPQEWKCDVDNDCGDHSDEPMPECLSHRCDNHTEFSCRTNYR
CIPQWAVCNGVDDCRDNSDEQGCEERTCKPSGEFRCNNHHCIPLRWKCDGHNDCGDHSDE
ENCVPRECSESEFRCDDHSCIPSRWVCDHTNDCGDNSDERDCEMKTCQPGYFQCQSGHCV
PEHLTCDGIADCLDASDEAACPTRFPNGAYCSATMFECKNHVCVRSSWKCDGDDDCGDGS
DEELHLCLDVPCESPYRFRCDNNRCIYKHELCNHVDDCGDGSDEKEEHCNLPTSRPCTEN
EFKCSNGHCISQHLVCDDVDDCGDHFDETGCNTGKERSCAENLCEQNCTQLNEGGFICSC
RPGFKASTLDRNSCDDINECEQFGVCPQNCQNTKGSYECSCAEGFRSESDQYGKRCAADG
NPPLLLLPENVRIRKYNLSSEKFSDYLEGEERIQAVDYDWDPEGIGLSVVYYTVLGHGSD
FGAIKRAYIPNFESDTNNLVSEVNLNLKYIMQPDGLAVDWVGRHIYWSDAKTKRIEVAEL
DGRYRKWLISNGLNQPAAVVVNPKLGLMYWTDWGGEPKIESAWMDGQHRKILVQEDLGWP
TGLAIDYWNNDRIYWSDFKENNIETIKHDGTDRRIVANAAMNPYSLDIFEGQFYWISKDK
GEVWKQDKFGRDEKEKMLMVNPWLTQARIFHQHRYDQSVPNRCKNICSHLCLLRPGGYSC
ACPQGSSFIAGSSIDCNAAIESPINMPPPCRCMYGGNCYFDENDLPKCKCPSGYMGKYCE
IGLSKGVPPGTTAVAVLLAVVLVIIVGTLAALGFFHYRRTGSLLPSLPKLPSLSSLVKSS
ENGNGVTFRSGADVNMDIGVSGFGPESAIDPSMVMSENFAMEMGKQPIIFENPMYASRDS
DVKVVQPTQVTVSGNVDNQNYGSPINPSEIAPDTKPTSPSADGTQATKWNIFKRKLKPTT
NFENPIYAEMENEQKESPAVAPPPAQSVPAKSSPRGPVPTYTATEDTFTDTANLVREDSE
V
Download sequence
Identical sequences G1LW61
ENSAMEP00000011312 ENSAMEP00000011312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]