SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011413 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011413
Domain Number 1 Region: 413-676
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.000000000288
Further Details:      
 
Domain Number 2 Region: 297-409,681-726
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000698
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 155-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 4 Region: 116-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 5 Region: 211-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 6 Region: 37-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 7 Region: 245-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 8 Region: 80-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011413   Gene: ENSAMEG00000010827   Transcript: ENSAMET00000011898
Sequence length 870
Comment pep:novel scaffold:ailMel1:GL192824.1:220917:252349:-1 gene:ENSAMEG00000010827 transcript:ENSAMET00000011898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLAPSLAEAGSMRPAGWGLCWAIALLLAATGAAVEDTCGRNEFQCQDGKCISYKWVCDG
SAECLDASDESQETCTLKSVCHLQVWGLGGRVNRCIPQPWRCDGQVDCENGSDEQGCLPR
TCAQNEFRCQDGKCIALDFVCDSDRDCLDGSDEASCPMPTCGPASFQCNNSACIPDLWAC
DGDPDCKDGSDEWPQRCGGRNTSAPQRDNGPCSSLEFYCRSGECIHSSWRCDGGPDCKDK
SDEENCTVATCRPDEFQCSDGTCIHGSRQCNRENDCKDMSDELGCINVTLCEGPNKFKCH
SGECITLDKVCNSIRDCRDWSDEPLKECGTNECLDNKGGCSHICNDLKMGYECLCPKGFR
LVDQRRCEDIDECQDPDVCSQLCVNLEGSYKCDCEEGFQLDPHTKACKAVGNIAYLFFTN
RHEVRKMTLDRSEYTSLIPNLKNVVALDMEVARNRIYWSDLSQRKIYSTHIDRATSFSSY
DTVISEDLQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFKEKGSKPRAIVVD
PVHGFMYWTDWGTPAKIKKGGLNGVDVYSLVTEDIQWPNGITLDLSGGRLYWVDSKLHSI
SSIDVNGGNRKIVLEDKKKLAHPFSLAIFEDKIFWTDIINEAIFSANRLTGSDINLVAEN
LLSPEDIVLFHNLTQPRGVNWCERTALRNGGCQYLCLPAPQINPHSPKFTCACPDGMLLA
KDMRSCLIGAEPGTTTRGTSTVTVRPTVRSTAVEPKHTASPWSVASPEFTTAETVTMSQH
ALGDAASRGDEEKPRSVGALYIILPIVLLILLCFGTFLLWKNWRLKSVNSINFDNPVYQK
TTEDEVHICYSQDGYTYPSRQMVSLEDDVA
Download sequence
Identical sequences G1LWG2
ENSAMEP00000011413 ENSAMEP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]