SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011425 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011425
Domain Number 1 Region: 812-1091
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-70
Family Protein kinases, catalytic subunit 0.00000704
Further Details:      
 
Domain Number 2 Region: 495-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-41
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 374-477,514-538
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-16
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000578
Family Third domain of FERM 0.016
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011425
Domain Number - Region: 125-224
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0262
Family Second domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011425   Gene: ENSAMEG00000010798   Transcript: ENSAMET00000011910
Sequence length 1104
Comment pep:novel scaffold:ailMel1:GL192348.1:1259124:1271955:-1 gene:ENSAMEG00000010798 transcript:ENSAMET00000011910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHVFSVEDSGTQVLVYRLRFYFPNWFGLEKCHRFRL
RKDLASAILDLPVLEHLFAQHRNDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQQ
PEELLKTVSYKVCLPPDLRDLIQGLSFVTRKRIRRTVRRALRRVTACQADRHSLMAKYIM
DLERLDPARAVETFLVSLPGAADGQDAQGLLRVAGDSGIAWSPGGQEALQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLTSDSRHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDCFLLTVCVQTP
LGPDYKGCLIRRDPTGTFSLAGLGRPHSSLRELLAACWDGGLHVDGVALNLTVCCTPKPK
EKSNLTVVRRGCNPPTSSPVQAQSQCQLSQMTFHKIPPESLEWHENLGHGSFTKIYRGCR
HEVVEGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVHLGALDTYLLKSGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLNREMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GIPMPISTLDPAKKLQFYEEQQQLPAPKWMELATLIQQCMAYESGQRPSFRAIIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYAYQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFEREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYASQICKGMEYLGSCRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYGNKSCSPSAEFLRMMECDRDVPALCRLLDLLAEGQRLPAPPACPGEVHELMKLCWAP
SPQDRPTFSALGPQLDALWSASRG
Download sequence
Identical sequences D2GV17
XP_011220341.1.58354 XP_011220346.1.58354 ENSAMEP00000011425 ENSAMEP00000011425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]