SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011986 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011986
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-17
Family V set domains (antibody variable domain-like) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011986   Gene: ENSAMEG00000011399   Transcript: ENSAMET00000012492
Sequence length 208
Comment pep:novel scaffold:ailMel1:GL195318.1:32786:38224:-1 gene:ENSAMEG00000011399 transcript:ENSAMET00000012492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQPRQQDMWLLPVLFLPVVQGHFSICQEGLVRGTEGGTLTAYCEYTPGWESYKKWWCRGK
NWISCRILVKTNGTDELVKKDRASIQDNSNRRTFTMILEKLRRDDADTYWCGIERTGVDP
VYKLSVIVDPGRHDSLLCSGALVPPAEGSGLFLCLPKGWRRDPLPAPSFFPSLLCSLHFA
LLTFVKVSLLGVLPCTVVWLSCSQGDPG
Download sequence
Identical sequences G1LY30
ENSAMEP00000011986 ENSAMEP00000011986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]