SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012054 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012054
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-36
Family Second domain of FERM 0.000000871
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-26
Family First domain of FERM 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012054   Gene: ENSAMEG00000011446   Transcript: ENSAMET00000012566
Sequence length 858
Comment pep:novel scaffold:ailMel1:GL192357.1:4387122:4490318:1 gene:ENSAMEG00000011446 transcript:ENSAMET00000012566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGDTNSGQQETQLEEASQEAAEGDNQCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKDVESAKEKCEGGQKEIEFG
TSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHREDPDFETKEGGGLEEC
SKIEVKEESPESKAERELKASQKSIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRV
CEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGADYVSDFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTDTLPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAAAVDADRSPRPTSAPAIAQSEDTEVSKAQKETVKVEEQKEEVPPEQAEPEPTE
AWKVEKTHIEVTVPTSNGDQTQIMAKQKLAEKTEDLIRMRKKKRERLDGENIYIRHSNLM
LEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQLPTGE
GPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQQTDDSNGDLDPGVLLT
AQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHP
DMSVTKVVVHQETEISEE
Download sequence
Identical sequences G1LY98
ENSAMEP00000012054 ENSAMEP00000012054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]