SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012301 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012301
Domain Number 1 Region: 888-1165
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-70
Family Protein kinases, catalytic subunit 0.00000591
Further Details:      
 
Domain Number 2 Region: 575-873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.56e-46
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 462-553,582-608
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000177
Family SH2 domain 0.0098
Further Details:      
 
Domain Number 4 Region: 374-438
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000565
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 5 Region: 147-271
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000146
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012301   Gene: ENSAMEG00000011557   Transcript: ENSAMET00000012827
Sequence length 1186
Comment pep:novel scaffold:ailMel1:GL192824.1:790437:806633:1 gene:ENSAMEG00000011557 transcript:ENSAMET00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVKSMPLCHWGATTRDSRPDGDGAQPMATRGGLKVLLHWAGPGGGDPWVTFSEATLTAEE
VCIHIAQKVGITPSCLNLFALFDAQAQVWLPPNHVLEISRDMSLTLYFRMRFYFRNWHGT
NPQEPAVYRCGPPGAKSSSEQAEQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEE
IHHFKNESLGMAFLHLCHLALCHGVPLEKVAKKISFKDCIPRSFRQQIRRHNALTRLRLR
NIFRRFVRAFQPGHVSQQVIMVKYLATLEQLAPRFGTERVPVCRLQLPAQAGGEPYYIRD
GGQAPPEPGPDLAPGPPTHEVLVTGTGGIQWRPVQAEGPRGDGSSRNPHAGPTGKKTKAP
EVVNQPADRPREAPWAYFCDFRDITHVVLKERHVSIHCQDNKSLELTLPSRAAALSLVSL
VDGYFRLTADSSHYLCHEVAPPRLVMSIQEGIHGPLLEPFVLAKLRAEDGLYLVHWSASH
LNRLILTVAQREQAPGTQHMHLRKFPIELQAGVFTLEGWDRSFPSVRELRAALQGCSLRA
GDDCFSLRRCCLPWPGEISNLIIMRGPRASTGPPNLSQLSFHRVCRDDITQLSHLGQGTR
TNVYEGILRVGGRSPEEGMADGEDPPTPSGDRGQELRVVLKVLDPSHHDIALAFYETASL
MSQVSHVHLAFVHGICVHGSENIMVTEYVEHGPLDVWLRREKGHTPVAWKVAVAQQLASA
LSYLEDKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWIAP
ECLSGGANSLTTAADKWGFGATLLEICFDGEAPLQGRGPSEKECFYQKQHRLPQPSCPEL
ATLTSQCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFHKRYLKKIR
DLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCSPQLRTGWRREIDILRTLYHKHIVK
YKGCCEDPGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHGQHYVH
RDLAARNVLLDNDRLVKLGDFGLTKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYA
SDVWSFGVTLYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPRPERCP
CEIYLLMKNCWEAEASFRPTFQNLIPILKTAQEKYQGQAASVFNVC
Download sequence
Identical sequences G1LYZ3
ENSAMEP00000012301 ENSAMEP00000012301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]