SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012538 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012538
Domain Number 1 Region: 45-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-273
Family Motor proteins 0.000000000161
Further Details:      
 
Domain Number 2 Region: 1954-2070
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-22
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 3 Region: 2071-2160
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-20
Family Third domain of FERM 0.02
Further Details:      
 
Domain Number 4 Region: 1251-1353
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000094
Family Ubiquitin-related 0.063
Further Details:      
 
Domain Number 5 Region: 1855-1962
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000168
Family Ras-binding domain, RBD 0.067
Further Details:      
 
Domain Number 6 Region: 1345-1446
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000089
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 7 Region: 800-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000011
Family Motor proteins 0.021
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000012538
Domain Number - Region: 1587-1629
Classification Level Classification E-value
Superfamily SH3-domain 0.000928
Family SH3-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012538   Gene: ENSAMEG00000011843   Transcript: ENSAMET00000013072
Sequence length 2175
Comment pep:novel scaffold:ailMel1:GL193664.1:382702:453166:-1 gene:ENSAMEG00000011843 transcript:ENSAMET00000013072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLCLQGDHVWLNPLSANKTSVAIGCIVKETKPGKILVEDDEGKEHWIRAEDLATLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLTRYRQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYCSHHMGELPPHVFAIANNCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATVSG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMAAEEKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
VRSAMKILMISDSEHWDLSKLLAAILHLGNVQFMAAVFENLDSSDVMDSPAFPTVLKLME
VEYQALRDCLIKHSIIIRGEFVTRPLNITQAADRRDAFVKGIYGHLFLWIVKKINTAIFT
PPGQDPKNVRRAIGLLDIFGFENFQNNSFEQLCINFANEHLQQFFVQHVFTMEQEEYLSE
NIAWDYIHYNDNRPTLDLLALKPMSIISLLDEESRFPKGTDITMLQKLNNVHANNKAYLQ
PKNIHDARFGITHFAGEVYYQTEGFLEKNRDVLSTDILTLVYSSKNKFLREIFKLESAGT
KSTDPSKQPSTLAGQFKKSLDQLMKILTGCQPYFIRCIKPNEYKKPLLFDRELCIRQLRY
SGMMETVHIRKSGFPIRYTFEEFSQRFGVVLPSAVRLQFLDKARQMTLRIAEMRLGTDKE
WKVGKTKIFLKDNQDTLLEVQRSEALDKAAVNIQRVLRGYKSSRKEFLRQRRAAVTLQAG
WRGYYNRRNFKQIILGFERLQAIARSQLLAKQYQIMRQRMVQLQALCRGYLVRQQVQAKK
RAVVVIQAHARGMAARRNFRQQKANAVRRDEQQHRALTRHSYPLRVQSHYCSRSSHHLGH
VGHPQEHAGCGIEEASCSVSPTEEQKSQTALPTRKRKSIYDTITDTEMVEQVFGFLPSMI
GGQEGQAPQRFEDLEARTQKLPEVDLDTVPMVEESEDDTDSLDEYTFPKFAATYFQKSAS
HTHIRRPLRSPLLYHENDADCSAALAVWSIILRFMGDLPEPVLFAGNGLHGGSVTQQIHD
TLGRENSTQPPQHGASTQTPAGSCVQTKCIEIQLKRSPRITGQVTSQLNIGEESFEPDGP
ISDRPMSNLEKVQFIVGYAILRRNLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGCF
PPSERFMKYLLNFIGQGPAGYGPFCAERLKRTYANGVRTEPPTWLELQAVKSKKHIPIHV
ALETGESLTVMVDSASTSREVCQHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHVMDA
VAQCEQLARERGENERQAPWRIYFRKEFFTPWHDSQEDSVSTQLIYCQVMHGVRSGEYTF
EKEEELVQLLAQRCYVQHGASVGSEAIRELLHSCVPSKLYRTKPPEKWASLVTAALAKAQ
YTQKQAKPLAVQEQVVDAARLQWPLLFSRLFEVTTLSGPRLPKTQLILAVNWKGIYFLDQ
KEKMLLELSFPEVMSLITNREAQGGQRLVVSTLHEEEYEFMSPSSVAIAELVAMFLEGLK
ERSVFAMALQDRKATGAQPGGEGRIVWKGDLLILTKKQGLLASEHWTLGQNDRTGKTGLV
PTACLYAIPTVTKPSAQLLSLLAMSPEKRKLAAQEGRPTEPLPGEQPKDKPHTLEEFSYE
FFRAPEKETVSRAMFPLARTRGHLWAHSPEPLRQPLLKCVHASAELRDLACQIFIDILPY
MGDYPSRQAWTSVELTDQIFSLALQDSALQDEVYCQILKQLTHNTKRYSEERGWQLLWLC
TGLFPPGKALLPHAQKFVDTRRKQLLAPDCSRRIQSILRTGPRKQPPHPMEVEAVEQNIS
RICHKIYLPNDTSEMLEVGTHTRVRDVCQSVATRLQLASWEGCSLFIKIADKVISQKEGD
FFFDSLRQVSDWVKKNKPQKEGAPVTLPYQVYFMRKLWLNVTPGKDVNADTILHYHQELP
KYLRGFHKCSREDAVHLAGLIYKAQFDNDRSQLASIPKILRELVPENLTRLMSSEEWKKN
ILLAYDKHKDKTVGEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDIILIAINRHGVLL
IHPKTKEPLTTYPFTKISSWSSGSTYFHMALGSLARGSRLLCETSLGYKMDDLLTSYVQQ
LLSSVNKQRGSQAPA
Download sequence
Identical sequences G1LZM8
ENSAMEP00000012538 ENSAMEP00000012538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]