SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012963 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012963
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-49
Family YWTD domain 0.0000000922
Further Details:      
 
Domain Number 2 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000209
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 235-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000122
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 357-434,701-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000863
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 10 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012963   Gene: ENSAMEG00000012233   Transcript: ENSAMET00000013507
Sequence length 873
Comment pep:novel scaffold:ailMel1:GL192649.1:1129356:1158630:-1 gene:ENSAMEG00000012233 transcript:ENSAMET00000013507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGTSARWALWLLLALCWAPRESRATEAGRKAKCEPSQFQCTNGRCIMLLWKCDGEEDCAD
GSDEKNCVKKTCAESDFVCNNGQCIPNRWQCDGDPDCEDGSDENPEECHMRACRRNEMSC
GARSAHCIPVSWKCDGENDCDSGKDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCG
DGSDELDCAPPTCRTHEFQCSNSSCIPLSWVCDDEADCANQSDESLEQCGHQPVMDTKCP
ASETQCGSGECIHKKWRCDGDHDCKDGSDEVNCPSKTCRPDQFGCEDGSCIHSSRRCNGI
RDCVDRSDEVNCKNVNQCLGPGKFKCRSGECIDIGKVCNQEQDCRDWSDEPLKECHVNEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDKKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIDLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKIIDNVYNPAAIAVDWVYKTIYWTDVASKTISVA
TLDGTKRKFLFNSGLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRQPLVTEDIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSQEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELVTLVNNLNDAQDIIVYHELVQPSGKNWCEEDMPNGGCEYLCL
PAPQINDHSPKYNCSCPNGYSLEENGRECHSTATPVTYSETKGIHATEIAPTSGLVPGGI
NVTTEVSEATVPPKGTSAAWAILPLLLLAMAAVGCYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences G1M0V3
ENSAMEP00000012963 ENSAMEP00000012963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]