SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013962 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013962
Domain Number 1 Region: 657-812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-36
Family MAM domain 0.0007
Further Details:      
 
Domain Number 2 Region: 975-1138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-30
Family MAM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 63-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-24
Family MAM domain 0.022
Further Details:      
 
Domain Number 4 Region: 815-972
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-23
Family MAM domain 0.0025
Further Details:      
 
Domain Number 5 Region: 273-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-17
Family MAM domain 0.014
Further Details:      
 
Domain Number 6 Region: 491-646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-16
Family MAM domain 0.012
Further Details:      
 
Domain Number 7 Region: 226-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 8 Region: 457-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000746
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000013962
Domain Number - Region: 25-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0196
Family LDL receptor-like module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013962   Gene: ENSAMEG00000013259   Transcript: ENSAMET00000014543
Sequence length 1221
Comment pep:novel scaffold:ailMel1:GL194396.1:59059:67235:1 gene:ENSAMEG00000013259 transcript:ENSAMET00000014543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGHLLPALVLLLAAGSPGWAWVPNNCRAPREATCNFVCDCPGCSDETQCGYHGASPT
PGAPFACDFEQDSCGWQDISTSGYSWLRDRAGATLEALGPRADHTLGTDLGPGWYMAVGT
HRGKEASTAALRSPVLHNAAPSCELRLWYHAASGDVAELRLELTHRAETLTLWQSSGPWG
PGWQELVVATGRIQDDFRVSWGGLGAGASREGFRVAVMGCPSSISAPQAHCPLGHHHCQN
MACVEPHQLCDGEDDCGDGSDEDAPACRHHTVTDFETGLGLWNHSEGWARNHSAGTRPPA
WPRRDHSRNSAHGSFLVSVAEPSAPAVLSSPEFQASDTRNCSLVFYHYLHGSEDGSLQLF
LQTQSPGSPQGPVLLRRRHGDLGAAWVRDRVDIQSERPFRILLTGHTGPGGVVSLDDLIL
SDHCQPVPAPTEVSSPPPGLWAPAPWTQLSSLLPQDFCEPGHLSCGDLCVPPEQLCDFQQ
QCEGGEDERECGTTDFESPAAGGWEDASVGRLQWGRLQAQESRGPGTEAGRAAAGHFLSL
QRAWGQLAAEARVLTPPLGPSGPRCELRMAYYFHSDPQGFLALAVVGGGSRELVWQAPSS
SKGWKVDTVLLGARRRPFRLEFVGLVDLDGPGEQGAGVDDVTLKDCSPVTATDKDSEVSC
NFERDTCGWHTGHLTDSHWRRIQSRGPGYDHTTGQGYFLLLDPTDPPARGPGAHLLTQPQ
APAAPQECLSFWYHLHGPQIGTLRLAVRREGEAETLLWSRTGTHGNRWHEAWATLHHQLG
SGAKYQLLFEGLRDGYHGTMALDDVAVRPGPCWAPRRCSFEDSACGFSSGGQGLWTRQAN
ATGHASWGPRTDHTTETAQGHYMVVDTSPQALPRGHVASLTSEEHRPLAQPACLTFWYHL
SLRNPGTLQVHVEEAGRRQVLSISAHGGFAWRLGSVDVQAERAWRXXXXXVAAGVEHSYV
ALDDLLLQDGPCPRPASCDFEAGLCGWSHLPWPGLGGYSWDWSSGATPSRYPQPPVDHTL
GTETGHFVLFETGVLGPGGRAAWLRSQPLPATKASCLHFWYRMGFPEHFYKGELRVLLNS
ERGQLTVWSTGGHLRHQWLEGQVEVASAEEFQIVFEATLSGQPALGPIALDDVEYLAGQH
CRLPASSQGDTALATSVPTVVGSALLALVLLVLLGLLGRRWLQKKGGCPSRGETTAVAPG
FDNIVFNADCVTLPASLTDHQ
Download sequence
Identical sequences G1M3P9
ENSAMEP00000013962 ENSAMEP00000013962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]