SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013985 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013985
Domain Number 1 Region: 200-441
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-83
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 110-207
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000209
Family Hepsin, N-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 63-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013985   Gene: ENSAMEG00000013261   Transcript: ENSAMET00000014567
Sequence length 445
Comment pep:novel scaffold:ailMel1:GL193703.1:454475:473845:-1 gene:ENSAMEG00000013261 transcript:ENSAMET00000014567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REELSGRHAREDPDSDQPLNSLDVTPLRKPRTPLETFKKVGVPIIAALLSLATIIIVAVL
IKVILDKYYFLCGQPLHFIPRQQVCDSQQDCASGEDEQHCVKTFPDGSPVAVRLSKDRST
LQVLDPATWSWASACFDNFTEALAKTACGQMGYDSKPTFRAVEIGPDQELDVVGITENGQ
ELQVQNLSGPCLSGSLVSLHCLACGESLKAPRVVGGETASVDSWPWQVSIQYNKQHICGG
SILDAHWILTAAHCFRKHHDVSTWKVRAGSDKLGNFPSLPVASIFLIELNATYPKEKDIA
LVKLQLPLTFSGTVRPICLPFFDEELTPATALWVIGWGFTEQDGGKISDTLRQASVQVID
HTRCNAEDAYQGEVTEQMLCAGIMEGGVDTCQGDSGGPLMYHSDQWQVVGIVSWGHGCGS
PSTPGVYTKVTAYLNWIYSVRKVSP
Download sequence
Identical sequences G1M3S2
ENSAMEP00000013985 ENSAMEP00000013985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]