SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014553 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014553
Domain Number 1 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 98-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000825
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014553   Gene: ENSAMEG00000013817   Transcript: ENSAMET00000015159
Sequence length 325
Comment pep:novel scaffold:ailMel1:GL193442.1:38014:194245:1 gene:ENSAMEG00000013817 transcript:ENSAMET00000015159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAESQLLPGNNFTNECNIPGNFMCGNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCG
PTFFPCASGIHCIIGRFQCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFIC
DGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLAL
VLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASE
VGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSADSAGSQAASSLL
STEDSGHSPGQAGPPPESTLGPRDS
Download sequence
Identical sequences G1M5D5
ENSAMEP00000014553 ENSAMEP00000014553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]