SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015316 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015316
Domain Number 1 Region: 3914-4107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-38
Family Laminin G-like module 0.00055
Further Details:      
 
Domain Number 2 Region: 4168-4370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-37
Family Laminin G-like module 0.00066
Further Details:      
 
Domain Number 3 Region: 3644-3852
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.46e-33
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 405-490
Classification Level Classification E-value
Superfamily Immunoglobulin 4.95e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 1956-2045
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 3578-3665
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 3297-3390
Classification Level Classification E-value
Superfamily Immunoglobulin 3.02e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 2634-2722
Classification Level Classification E-value
Superfamily Immunoglobulin 3.32e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 1677-1772
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 3500-3587
Classification Level Classification E-value
Superfamily Immunoglobulin 5.95e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 2051-2137
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 12 Region: 3216-3307
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-17
Family I set domains 0.0089
Further Details:      
 
Domain Number 13 Region: 3114-3207
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 14 Region: 2443-2530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 15 Region: 1773-1860
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-16
Family I set domains 0.0000262
Further Details:      
 
Domain Number 16 Region: 1866-1953
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 17 Region: 2832-2918
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.027
Further Details:      
 
Domain Number 18 Region: 3028-3123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000169
Family I set domains 0.014
Further Details:      
 
Domain Number 19 Region: 2736-2819
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000018
Family I set domains 0.074
Further Details:      
 
Domain Number 20 Region: 2931-3015
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000422
Family I set domains 0.074
Further Details:      
 
Domain Number 21 Region: 2251-2331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000526
Family I set domains 0.06
Further Details:      
 
Domain Number 22 Region: 2543-2626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000136
Family I set domains 0.033
Further Details:      
 
Domain Number 23 Region: 2162-2245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000292
Family I set domains 0.052
Further Details:      
 
Domain Number 24 Region: 3405-3496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000704
Family I set domains 0.02
Further Details:      
 
Domain Number 25 Region: 2349-2435
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000753
Family I set domains 0.066
Further Details:      
 
Domain Number 26 Region: 765-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 27 Region: 1564-1616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 28 Region: 282-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 367-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 324-360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 1160-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 32 Region: 825-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000754
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 33 Region: 3846-3887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000355
Family EGF-type module 0.015
Further Details:      
 
Domain Number 34 Region: 195-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 1623-1671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 36 Region: 4111-4153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000192
Family EGF-type module 0.011
Further Details:      
 
Domain Number 37 Region: 1221-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000015316
Domain Number - Region: 886-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 1276-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000879
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1529-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00594
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 1123-1162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00773
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 727-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0177
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015316   Gene: ENSAMEG00000014404   Transcript: ENSAMET00000015954
Sequence length 4396
Comment pep:novel scaffold:ailMel1:GL192679.1:466553:532097:-1 gene:ENSAMEG00000014404 transcript:ENSAMET00000015954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLAWGEFFFLFLFHFILFEVTHGLQAYDGLTLPEDAETVTVGRAGWRYSDLSDDEDLL
ADEASGDGLGSGDLGSGDFQMVYFRALVNFTRSIHYSPRLEDAGSEEFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQGVLHTVVSSGSIASYITS
PQGFQFRRLGTVPQVSRECTEAEFACHSHNECIALEYRCDRRPDCRDMSDELNCEEPVPE
LSSVAPALAETTPLAPEPEVTTPQPLPGVPAPQLLVPSPGRPLPCGPHEATCHSGHCIPK
DYICDGQEDCKDGSDELDCGPSPPCEPNEFPCGNGHCALKLWHCDGDFDCEDRTDETDCP
AKRPEDVCGPTQFRCVSTNTCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQESIQASR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLTIRDVKEADQGAYTCE
AMNARGMVFGIPDGVLELIPKRAGPCPDGHFYLEHSASCLPCFCFGVTNVCQSSRRFRDQ
IRLRFDRPDDFKGVNVTMPSQPGMPPLSSTQLQIDPALQEFQLVDLSRRFLVHDSFWTLP
EQFLGNKVDSYGGSLHYKVRYELARGMLEPVQRPDVVLVGAGYRLLSRGHVPTQPGTLNQ
RQVQFSEEHWVHESSRPVQRAEMLQVLQSLEAVLIQTVYNAKMASVGLSDIAMDTTVTHA
TSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGH
CLNCQHNTEGPQCNKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATC
DACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTNQEIVRCDERGSTGTSGEACRCKNNVV
GRLCNECVAGSFHLSARNPDGCLKCFCMGVSRQCTSSSWSRAQVRGASEEPGQFSLTNAA
GTHTTSEGVSSPAPGELVFSSFHNLLAGPYFWSLPQRFRGDKVTSYGGELRFTVTQRPQP
GSSPLHGQPLVVLQGNGIVLEHHTSQDPSPGQPSTFTVPFREQAWQRPDGQPATREHLLM
ALAGIDTLLIQASFTQRPAESRVSGISMDVAVPEDTGQDPALEVEQCTCPAGYRGPSCQD
CDTGYTRMPSGLYLGTCERCSCHGHTEVCEPETGACQGCQHHTEGPQCEQCQPGYYGDAQ
RGTPQDCQPCPCYGAPAGGQATHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQ
GQPCRRDDQLPEPIGCGCDPQGSISSQCDAAGQCHCKAQVEGLTCSHCRPHHFFLSASNP
NGCLPCFCMGVTQQCASSSHSRHLISTRFAPGDFQGFALVNPQRNSRLTGGFAVEPVPEG
AQLTFGNFAQLGHESFYWQLPEAYQGDKVAAYGGKLRYTLSYTAGAQGSPLSDPDVQIMG
NNIMLVASQPALQGSERKNFEITFREEFWRRPDGQPPTREHLLMALADLDELLVRATFSS
MPLAASISSVSLEVAQPGPSEGPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGH
CELCECNGHSELCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTN
PENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPNVRGSRCLPQADAAPLVV
QVHPAQSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPMPSSSQQRHQGSELHFPSVQPS
DAGVYVCTCRNLHHANSSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKS
PAYTLVWTRLHNGKLPARAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQA
SGTSSAPVVSIHPPQLTVQPGQLAEFRCSATGNPAPTLEWTGGPGGQLPQKAQIHGGILR
LLAVEPSDQAQYLCRAHNSAGQHVARAVLHVHGGSGPRVQVSPERTQVHEGRTVRLYCRA
AGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITAADAGFYLCVATSPAGTAQARIQ
VVVLPASGASSPPVRIESSSPSVTEGQTLDLNCVVAGLAHISITWYKRGGSLPPHSQVHG
SRLRLSRVSPADSGEYVCRVENESGPKEASIIVSVFHSTHSGPSYTPAPGGAPAPGGSQP
IRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPARHQTHGSLLRLHQVSPADS
GEYVCRVVLGSGPLETSVLVDIKASAPGPVPPVRIESTSPTVAEGQTLDLSCVVAGQAHA
QVTWYKRGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGMEASITVTVTRTQGANFA
YPPGSSQPIRIESSSSHVAEGQTLDLNCVVPGQAHAHVTWHKRGGSLPARHQTHGSLLRL
HQVSPVDSGEYVCRVVGGSVPLEASVLVTIEPAGSVPALGVIPPVRIESSSSHVAEGQTL
DLNCVVPGQAHAQVTWHKRGGSLPAQHQVHGSRLRLPQVTPADSGEYVCRVVSNSGTQEA
SVLVTIQQRLGPSHPQGVVYPVRIESSSASLANGHVLDLNCLVASQAPHTITWYKRGGSL
PSRHQIVGSRLRIPQVTPADSGEYVCHVSNGGGSQETSLIVTIEGSGSSHVPSVSPPIRI
ESSSPTVVEGQTLDLNCVVAGQPQATITWYKRGGSLPAQHQAHGSRLRLNRMSVADSGEY
VCRANNNIDAQEASIMVSVSPSASSPSVPGGAVPIRIESSSSHVAEGQTVDLNCVVPGQA
HTQVTWHKRGGSLPTHHQTHGSRLRLYQVSPEDSGEYVCQVVSGSGPLEASVLINIEASG
SSAVPVPAPGGAPSIRIETSSSHVAEGQTLDLNCVVPGQPYAQVTWHRRGGSLPARHQVH
GPLLRLNQVSPADSGEYLCRVTSGSGTLEASVLVTIEASSPGPIPAPGLAQPIYIEASSS
HVAEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLPHVSPADSGEYVCRVA
SGSGPEQEASFTVTVPPSAGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHEGAAPISL
EWRTGGEDSGDNVQISPNGSIITIVGTRPSNQGAYRCVASNAYGVAQSVVNLSVHGPPTV
SVLPEGPVRVKVGKSVTLECVSAGEPRSSARWTRIGAPTNVEQRMYGVVDSHTVLQISSA
KPSDAGIYVCLAQNALGTAQKRVEVIVDTGAVAPGAPQVQVEEAELTIEAGHTATLRCSA
TGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRIAQQDSGQYICNATSPTGHAEATIALHV
ESPPYATTVPEHASVRAGETVQLQCLAHGTPPLTFQWSRVGGSLPRRVTPRNEMLRFEPA
APEDSGRYRCRVTNKVGSAEAFAHVLVQGPSGSVSATAIPAGSTPTVQVTPQLETKSIGA
SVEFHCAVPPDRGTRLRWIKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQA
QASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGRLRPGIVQ
SGGVIRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAAFP
CMASGYPTPDITWSKLDGDLPPDSRLENHVLLLPSVRPQDAGTYVCTATNRQGKVKAFAH
LQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKQIPGSPTN
LANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGS
LAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFVGCVRELRIQGEEIVFHDL
NLTAHGISHCPTCRDRPCQNGGQCQDSESGSYVCVCPAGFTGSRCEHSQALHCHPEACGP
DATCVNRPDGRGYTCRCHLGRSGVRCEEGVTVTTPSMSGTGSYLALPALTNTHHELRLDV
EFKPLAPDGILVFSGGKSGPVEDFVSLAMAGGHLEFRYELGSGLAVLRSPEPLALGHWHR
VSAERLNKDGSLRVNSRPPVLRSSPGKSQGLNLHTLLYLGGVEPSVRLPPATNVSAHFRG
CVGEVSVNGKRLDLTYSFLGSQGVGQCYTSSPCERQPCRNGATCMPAGEYEFQCLCADGF
KGDLCEHEENPCQLREPCLHGGTCQGTRCLCPPGFSGPRCQQGSGQGTVEPDWHLEGSGG
NDAPGQYGAYFHDDGFLALPGHIFSRSLPEVPETIELEVRTSTANGLLLWQGVDVGEAGR
GKDFISLGLQDGHLVFSYQLGSGEARLVSEDPIDDGEWHRVTALREGRRGSIQVDGEELV
SGQSPGPNVAVNTKGGVYLGGAPDVTTLTGGRFSSGITGCIKNLVLHSARPGAPPPQPLD
LQHRAQAGANTRPCPS
Download sequence
Identical sequences G1M7J6
ENSAMEP00000015316 ENSAMEP00000015316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]