SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015988 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015988
Domain Number 1 Region: 872-1145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-68
Family Protein kinases, catalytic subunit 0.00000704
Further Details:      
 
Domain Number 2 Region: 564-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 421-545
Classification Level Classification E-value
Superfamily SH2 domain 1.65e-16
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.11e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 5 Region: 365-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000111
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015988   Gene: ENSAMEG00000014980   Transcript: ENSAMET00000016655
Sequence length 1153
Comment pep:novel scaffold:ailMel1:GL193175.1:460263:506469:1 gene:ENSAMEG00000014980 transcript:ENSAMET00000016655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPNDSGNLLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGT
LVDYKDDEGTAEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
YSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPLHCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
Download sequence
Identical sequences G1M9G8
ENSAMEP00000015988 ENSAMEP00000015988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]