SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015991 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015991
Domain Number 1 Region: 172-314
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 68-174
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-30
Family Second domain of FERM 0.0000935
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-21
Family First domain of FERM 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015991   Gene: ENSAMEG00000015158   Transcript: ENSAMET00000016658
Sequence length 550
Comment pep:novel scaffold:ailMel1:GL192356.1:860737:905546:1 gene:ENSAMEG00000015158 transcript:ENSAMET00000016658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCF
RVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQQAEIGDYDPG
KHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHP
CKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILT
YFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESS
AKIKREPPEIHRSQKLQKTSLHSLNDQCLLNYEPLRPVGLSPAAKGYEEPCAGGAEVPEE
GGVEEPLCTLECVKTGNCQPTVDPAPSKVKNSNERVAVIADEAYSPADSVLPTPVAEHSL
ELMLLSRQINGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHGRPEEEQVNKFVLS
VLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKI
RSVVSLLIDT
Download sequence
Identical sequences G1M9H1
ENSAMEP00000015991 ENSAMEP00000015991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]