SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016113 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016113
Domain Number 1 Region: 576-664
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 523-575
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000759
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000016113
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00887
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016113   Gene: ENSAMEG00000015209   Transcript: ENSAMET00000016784
Sequence length 687
Comment pep:novel scaffold:ailMel1:GL192689.1:18344:101903:-1 gene:ENSAMEG00000015209 transcript:ENSAMET00000016784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQPGYIRD
LITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRL
IRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGY
IFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences A0A2J8WKS9 A0A2K5Q0B4 A0A2K6FDK3 D2HCK7 L8ICB8
XP_004415882.1.74151 XP_004738861.1.14098 XP_005211923.1.76553 XP_005899371.1.15283 XP_006199829.1.17985 XP_010846046.1.44457 XP_010960471.1.22495 XP_010981235.1.51371 XP_012613456.1.48125 XP_017203800.1.1745 XP_017367882.1.71028 XP_019581271.1.88060 XP_019655649.1.58354 XP_019824481.1.53367 ENSAMEP00000016113 ENSAMEP00000016113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]