SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016257 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016257
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000107
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 3 Region: 626-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000792
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000417
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000016257
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00963
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016257   Gene: ENSAMEG00000015352   Transcript: ENSAMET00000016931
Sequence length 843
Comment pep:novel scaffold:ailMel1:GL192928.1:190293:237240:-1 gene:ENSAMEG00000015352 transcript:ENSAMET00000016931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVIALFILVGFTGEFQVFSRASSPVNCQWDSYASWSECNGCTKTQTRRRSVAVYGQYGG
HPCVGSAFETQSCEPTLGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCEEDSADEDRCE
DSESRPSCDLDKPPPNIELTGNGYNELTGQFRKRVINTKSFGGQCRKVFSGDGKDFYRLS
GNILSYTFQVKINNDFNYEFYNSSWSYVKHTSAEHTSSSRKRSFFRSSSSSHTSHTSHSN
EIHKKKSHHLLVVQNTVEVAQFVNNNPEFLQLAEPFWKELSFLPSLYDYSAYRRLIDEYG
THYLQSGSLGGEYKVLFYADSDKIKKSGLSSADMKSCTASTFKFVFRSSKGKCKELEEAL
KSDSGTQGNVLRGDPFVRGGGSGFVSGLSFLELDNPAGNKQRYSSWAESVTGLPQVIKQK
LTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCQPCQNGGIATVEGTQCQCHCKPY
TFGVACEQGVLVGNEAGGVDGGWSCWSSWGPCVHGKKTRRRECNNPPPSEGGQSCIGEPL
ESSPCEDEELQHLRLLEPHCFPLSLAPKEFCPSPPALKDGFVQDEGVMFPVGKNVVYTCN
EGYSLIGDPVARCGDDSRWLVGEMHCQKIACVLPASMDGIQSHPHKPFYEVGEKVTISCS
GGMSLEGPSAFLCGSSLKWSPDMKSVHCVQKDAPLPSAMPECQLWEKLQNSRCVCKMPYE
CGSSLDVCARDERNKKILPLTVCKMHVLHCQGRNYTLAGRDSCALPAPTEKACGACPLWG
KCDAPSSKCVCREASECEEGGFRVCVAVGGVEQTMSECAAGALRCRGQDITVTSTGPCAA
GTP
Download sequence
Identical sequences G1MA83
ENSAMEP00000016257 ENSAMEP00000016257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]