SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016315 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016315
Domain Number 1 Region: 7-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.46e-263
Family Motor proteins 0.000000000212
Further Details:      
 
Domain Number 2 Region: 1170-1267
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-28
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1350-1470
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1753-1822,1865-1909
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-17
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 5 Region: 1288-1342
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000226
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1133-1171
Classification Level Classification E-value
Superfamily PH domain-like 0.000000175
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000016315
Domain Number - Region: 1660-1746
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0289
Family Ras-binding domain, RBD 0.035
Further Details:      
 
Domain Number - Region: 785-891,1173-1198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0366
Family FCH domain 0.055
Further Details:      
 
Domain Number - Region: 1913-1999
Classification Level Classification E-value
Superfamily PH domain-like 0.0676
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016315   Gene: ENSAMEG00000015404   Transcript: ENSAMET00000016991
Sequence length 2017
Comment pep:novel scaffold:ailMel1:GL193156.1:185230:300601:-1 gene:ENSAMEG00000015404 transcript:ENSAMET00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFTYKQSTITHQKVTAMHPMNEEGVDDMAALTELHGGSIMHNLYQRYKRNQIYTYIGSI
IASVNPYKTIAGLYERAAMERYSKCHLGELPPHVFAVANECYRCLWKRHDNQCVLISGES
GAGKTESTKLILKFLSVISQQSLELSLKEKTSCVEQAILESSPIMEAFGNAKTVYNNNSS
RFGKFVQLNICQKGNIQGGRIVDCILFHNRVVRQNPGERNYHIFYALLAGLEHEQRVEEF
YLSVPENYHYLSQSGCVEDKTISDQESFREVITAMEVMQFSREEVREVLRLLAGVLHLGN
IEFITAGGAQVSFKTALGRSAELLGLDPAQLTDALTQRSMFLRGEEILTPLTVQQAEDSR
DSLAMALYARCFEWVIKKINSRIKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKL
QEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDS
TLLEKLHNQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRE
SRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIK
PNTQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGFAVRRPFQDFYKRYKVLMRNVAVPDD
IRGKCTALLQLYDSSNSEWQLGKTKVFLRESLEQKLEKQREEEVMRAAMVIRAHILGYLA
RKQYRKVLCCVVIIQKNYRAFLLRKRFLHLKKAAIVFQKRLRGQIARRIYRRLLAEKREE
EEKRKREEEEQRKREEEERERERARREAELCAQQEEAARKQQELEALQKSQRDAELPCDL
EKQKENKQVEEILRLEKEIEDLQRMKERQELSLTEASLQKLQQLRDEELKRLEDEACRAA
QEFLESLNFDEIDECVRNIERSLSVGSEFSGEPAVPAEGAGADKPSFNFSQPYPEEEVDE
GFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDESSEEDPYMNDTVVPTSPSADSTVLLAP
SEHGSSGGEPTYCLPQSGGGLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDY
RCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSF
LYMKGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVL
RQSKLMYFENDSEEKLKGTLEVRTAKEIIDNTSKENGIDIIMADRTFHLIAESPEDASQW
FSVLSQVHASTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRV
LHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVL
THNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYSKL
LNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSEVVEQIYKRNPILRHTHHPLH
SPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRP
LRDELYCQLIKQTNKVPQPGSAGNLCSWQILTCLSCTFLPSRGILKYLRFHLRRIREQFP
GTEMEKYSLFIYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTT
AGEVVEKLIRGLAMEDSRNMFALFEYNGSVDKAIESRTIVADVLAKFEKLAAASEVGDLP
WKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIRGHYPAPEENLQVLAALRLQYLQGD
YSLHASVPPLEDVYSLQRLKARISQSTKSFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQ
KVEEEQMLDMWIKEEVSSARASIIDKWKKLQGMGQEQAMAKYMALIKEWPGYGSTLFDVE
CKEGGFPQDLWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLF
ETSEVVDVAKLMKAYISMIVKKRYSTSRSVSSQGSSR
Download sequence
Identical sequences G1MAE1
ENSAMEP00000016315 ENSAMEP00000016315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]