SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017298 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017298
Domain Number 1 Region: 35-146
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-20
Family V set domains (antibody variable domain-like) 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017298   Gene: ENSAMEG00000016373   Transcript: ENSAMET00000018007
Sequence length 288
Comment pep:novel scaffold:ailMel1:GL193002.1:114923:124342:1 gene:ENSAMEG00000016373 transcript:ENSAMET00000018007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPRAPWPLVWAVLQLGWWPGWLLDSPERPWSPLTFSPAQLAVHEGENATFTCSLSSVP
ESFVLNWYRMSPRNQTDKLAAFQEDRIQPGPDRRFHVTRLPNGRDFHMSIVATQLSDSGT
YLCGAIYLPPNTQINESPRAELTVKERILEPPTESPSPPPRITNQLQGLVIGITSVLVGV
PLLLLVTWVLAAAFPRATRGTCACGSEDAPLKEGPSAAPVFTVDYGELDFQWREKTPEPS
APCAPEQTEYATIVFPSRPGSPGRRASAHSPQGPQPLSPEDGPCPWPL
Download sequence
Identical sequences G1MD70
ENSAMEP00000017298 XP_002923181.1.58354 ENSAMEP00000017298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]