SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017464 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017464
Domain Number 1 Region: 537-754
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-51
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-41
Family Third domain of FERM 0.0006
Further Details:      
 
Domain Number 3 Region: 898-1027
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-30
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 133-233
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-29
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 739-863
Classification Level Classification E-value
Superfamily PH domain-like 2e-28
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Domain Number 6 Region: 52-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-21
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017464   Gene: ENSAMEG00000016513   Transcript: ENSAMET00000018176
Sequence length 1034
Comment pep:novel scaffold:ailMel1:GL193002.1:343995:435957:-1 gene:ENSAMEG00000016513 transcript:ENSAMET00000018176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGTRLGAQAPAGVSTLEPGQTLSAGAARASARMQEKHLHIRVKLLDN
TVEIFDIEPKRDGQTLLTQVWRHLNLTECDYFGLEFQHPRSYWIWLEPMKPIIRQVRRPK
NALLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLPCTDTTAALLASHLLQAEIG
DYDETLDREHLKANEYLPSQEHSLEKILEFHRKHMGQTPAESDFQVLEIARKLEMYGIRF
HTASDREGARINLAVSHMGVLVFQGTTKINTFNWSRVRKLSFKRKRFLVKLHPEVRGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKARAKAVLFSRGSSFRYSGRTQKQLVD
YVRDSGVKRVSYDRRHSKTRMSVRALTADLPRQSISFTEGMRTSASPSSTNAFFCSVPTS
PLAPRGPPDFKDSSGSLTEPQAPDAKRPVAERSTGAAADSDARRAQSPGPPALQPCQGLS
TESPQPSPSTRKSPLSLSPASQVTLDPAGQGLSPLLSPVLSDAGGARMDSEEEPKHKSTA
ADEAYFIVEEILATERTYLKDLEVLTVWFRSAVVKEDAMPADLMSLLFSNIDPIYEFHRG
FLREVEQRLALWEGSSNAHATGGHQRIGDILLRNMHQLKEFTSYFQRHDEVLTELEKATK
RSKKLETVYKEFELQKVCYLPLNAFLLKPIQRLVHYRLLLGRLCGHYAPTHPDSADCRDA
LQVITEVTSTLQHSLARLETLQKLTELQRDLVGVENLLAPGREFIREGCLHKLTRKGLQQ
RMFFLFSDMLLYTSKGVTGTSRFRIRGLLPLRGMLVEGGEHERSVPHCFTICAAQKTVVV
AASTRLEKEKWIRDLNTAIDAAKGGSDQSLALPGGVVCTPPDRSSEVCVEQESEGARGSL
EGQGQRRANTTVHVCWYRNTSVSRADRSAAVENQLSGYLLRKFKNSTGWQKLWVVFTDFC
LFFYKTHQDDHPLASLPLLGYSVSVPQEADGVHKEHVFKLQFKSHVYFFRAESKYTFGRW
MEVIERAGSSPGRA
Download sequence
Identical sequences D2HLD0
ENSAMEP00000017464 ENSAMEP00000017464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]