SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017829 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017829
Domain Number 1 Region: 241-303
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 2 Region: 383-443
Classification Level Classification E-value
Superfamily BPTI-like 4.11e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0052
Further Details:      
 
Domain Number 3 Region: 332-369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000017829
Domain Number - Region: 208-243
Classification Level Classification E-value
Superfamily PKD domain 0.0785
Family PKD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017829   Gene: ENSAMEG00000016874   Transcript: ENSAMET00000018554
Sequence length 533
Comment pep:novel scaffold:ailMel1:GL192356.1:3433361:3444512:-1 gene:ENSAMEG00000016874 transcript:ENSAMET00000018554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPGRMMARARLSRTRVPAVAVWLLCALDLLGTEAGPPPGPPGLPPGGPCLDRFTAGVPA
FVLDTEASVSNGATFLGSPAVRRGWDCVRACCTTQNCNLALVELPPDRGEDAIVACFLMN
CLYEQNFVCKFAPREGFVNYLTREVYHSYRELRTQGFGGSRIPKAWAGIDLKVQPQEPLV
LKDVENTDWYLLQGDTDVRVEKSEPDQVKLWGLKEGTYLFQLTAADSDQPESMTNVTVTV
LSPKQTEEYCLASSKVGRCRGSFPRWYYDPKEQICKSFVYGGCLGNKNNYLREEECKLAC
RDVQGGPLRGSFGTQVTCPQGPALDRHRPVCSGTCHPTEFRCRDGCCIDSFLECDDTPDC
PDASDEATCEKYTSGFEELQNIHFRSDKGHCVDLPDTGLCLENIPRWYYNPFSERCARFT
YGGCFGNKNNFEEEQQCLASCRGISKKDVFGLRRESPIANIGSVEMAVAVLLVTCIVVVI
ALLGYCFFKTQRKEFHRHRPHPHQLQPPTPASSMVSTTEDTEHLVYNHTTQPL
Download sequence
Identical sequences G1MEQ0
ENSAMEP00000017829 ENSAMEP00000017829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]