SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018064 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018064
Domain Number 1 Region: 102-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 41-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000418
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 512-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000313
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018064   Gene: ENSAMEG00000017094   Transcript: ENSAMET00000018795
Sequence length 551
Comment pep:novel scaffold:ailMel1:GL192396.1:254176:303939:1 gene:ENSAMEG00000017094 transcript:ENSAMET00000018795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGQWFAFALCILEISVLTAGPTPSYAPQITQDNERPLPIDCRMSSWSEWSECDPCLKQ
MFRSRSIEIFGQYNGQKCVDALGDRRQCEPTEACADVEEDCGNDFKCGTGRCIKRRLLCN
GDNDCGDFSDEDDCESDPRPPCRERAVEESELARTAGYGINILGMDPLSTPFDNEYYNGL
CDRVRDGNTLVYYRRPWNVASLAYETKADKSFRTEYYEEQMEAFKRIVQQKTSNFNADIT
LKFTPIEAIEKSKSIPKESPDKKDSSLTNAESKFRFTYSKNETYQLFLTHSSKKEKVFLH
VKGLIHLGRFVMRGRDAMLTTTFLDDIKALPATYAKGEYFAFLETYGTHYSSSGSLGGFY
ELIYVLDKASMEEKGVEIRDVQRCLGFNLDFSLKAGVTVKGQINKNDCLKRGEGGNVNIT
RDGIIDDVISLIRGGTQKYAYELKEKLLKGPETVDMTDFVNWATSLNDAPVLINQKLSPI
YNLVPVKIKDAHLKKQNLENALEDYLSEFSVRKCDPCQNGGTVILLEGECLCSCPIAFTG
IACETSKGKNL
Download sequence
Identical sequences G1MFD4
ENSAMEP00000018064 ENSAMEP00000018064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]