SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018522 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018522
Domain Number 1 Region: 127-207
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000017
Family Second domain of FERM 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018522   Gene: ENSAMEG00000017530   Transcript: ENSAMET00000019266
Sequence length 465
Comment pep:novel scaffold:ailMel1:GL192492.1:820890:841070:-1 gene:ENSAMEG00000017530 transcript:ENSAMET00000019266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTEGNAGQPGPAERSHRSSVSSVGARVADVLVYLADDTVLPLAVENLPSLSAHELHRA
VREVLQLPDIALDAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTDASDDDVAVDE
PSLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQL
GPYQPGQPTACALREKLDSFLPAHLCKRGQGLFAAFRGRGAKAATGEQGLLNAYCRVKEA
VGADGERGASLSPHYRAYLLKSHELPFYGCAFFHGEVDKPAQGFLHRGRGGGKPVAVAIS
LEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEESVLWLEFDGDNEGTPVNRLLKIYSKQ
AELMSGLIEYCIELNQTSEPAAPQENVPGPAAGSPLPPAQRPPLRRQGSVMCSRLQHLST
IDYVEEGQQIKRVKPKRTASFFSRQLSTGQGSYTAVQPTDSLEQG
Download sequence
Identical sequences G1MGN8
XP_002916687.1.58354 ENSAMEP00000018522 ENSAMEP00000018522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]