SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018731 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018731
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018731   Gene: ENSAMEG00000017731   Transcript: ENSAMET00000019481
Sequence length 306
Comment pep:novel scaffold:ailMel1:GL192964.1:270498:520262:-1 gene:ENSAMEG00000017731 transcript:ENSAMET00000019481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIVIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRQEDGLQPEGRLWPSD
SSGPRPGASEIMYAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCALQLRDPEQQRELNRESVRAPPNRTIFDSDLIDISVYSGGPCPPSSNSGISAS
TCSSNGRMEGPPPTYSEVMGHYPGASFFHHQHSGAHRGSRLPFQQDSSGATVLPIQGKDR
KPGNLV
Download sequence
Identical sequences G1MH97
XP_019658942.1.58354 XP_019658943.1.58354 XP_019658944.1.58354 XP_019658945.1.58354 XP_019658946.1.58354 XP_019658947.1.58354 XP_019658948.1.58354 ENSAMEP00000018731 ENSAMEP00000018731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]