SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019071 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019071
Domain Number 1 Region: 630-904
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000727
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-35
Family Third domain of FERM 0.00018
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-32
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 4 Region: 508-596
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.0000991
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-18
Family First domain of FERM 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019071   Gene: ENSAMEG00000018026   Transcript: ENSAMET00000019832
Sequence length 914
Comment pep:novel scaffold:ailMel1:GL192486.1:2061279:2135456:1 gene:ENSAMEG00000018026 transcript:ENSAMET00000019832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVVCSIRFLDGLVQTFKANKQDTGQVLLDMAYN
HLGVTEKEFFGLQHGEDSVDSLRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQEE
QTRHLYFLQLKTDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHSGRDLHNLELMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQGKNVLSQYWAMGSRNPKKSLSNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPQHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSESEVSQNRSPHLESISENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSTEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRTSVF
GESDYRELNRLISCFKPSAFSPICPEGGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPG
LAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIAAQG
PLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEHGHFHIRCVSEDC
TLAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNSVRSLRVDGEPVL
VHCSAGIGRTGVLVTMETAMCLTERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAIL
RVYEEGLVQMLDPS
Download sequence
Identical sequences G1MI86
ENSAMEP00000019071 ENSAMEP00000019071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]