SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019088 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019088
Domain Number 1 Region: 521-609
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-18
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 2 Region: 331-423
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-18
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 3 Region: 221-272
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000106
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 4 Region: 436-520
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000131
Family Second domain of FERM 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019088   Gene: ENSAMEG00000018044   Transcript: ENSAMET00000019849
Sequence length 634
Comment pep:novel scaffold:ailMel1:GL192492.1:1808898:1825354:-1 gene:ENSAMEG00000018044 transcript:ENSAMET00000019849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTATGDYIDSSWELRVFVGEDDPEAESVTLRVTGESHIGGVLLKIVEEIKRKQDWS
DHAIWWEQKRQWLLQTHWXPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELSLLRAP
EKKEKKKKEKEPEEELFDLTXPGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLL
LQRLPRPSSLLDKTQLHSRWLDSSRCLMQQGIKAGDMLWLRFKYYSFFDLDPKTDPVRLT
QLYEQARWDLLLEETDCTEEEMMVFAALQYHINKLSQSGEAGETTGTDPGLDDLDAALNN
LEVKLEGSASTDVLDNLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETNLSYYKSQDE
APGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIHLRCQDENQYAHWMAGCR
LASKGRTMADSSYASEVQAILAFLSLQRTGGGGSGNHPQGPDASAEGLNPYGLVAPRFQR
KFKAKQLTPRILEAHQNVAQLSLSEAQLRFIQAWQSLPDFGISYVVVRFKGSRKDEILGI
ANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIQQVAIEFDEHINVAFSCVSASCRIVHE
YIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF
Download sequence
Identical sequences G1MIA3
ENSAMEP00000019088 ENSAMEP00000019088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]