SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019176 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019176
Domain Number 1 Region: 582-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-80
Family Eukaryotic proteases 0.0000486
Further Details:      
 
Domain Number 2 Region: 85-217
Classification Level Classification E-value
Superfamily SEA domain 5.49e-23
Family SEA domain 0.0071
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000406
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 4 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 360-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000981
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019176   Gene: ENSAMEG00000018147   Transcript: ENSAMET00000019940
Sequence length 829
Comment pep:novel scaffold:ailMel1:GL192529.1:1081737:1117273:-1 gene:ENSAMEG00000018147 transcript:ENSAMET00000019940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKEKMDVLSKPADGSISNIPVQVISTQGKLPGRRAPRKPVGKAKPKKPSKKKAPFWNVQ
NKIIVFTVVLFILAVIAWILLWLYIRRTESKDAFYFVGMFRITNIEFLPEYRQKESREFL
SVARTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWIVFVMPHAKGHIFCED
CVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTVGSDKGCSQHLYAD
HLSLRYPLEISATSGLLLCHFKLVAIVGYLIRLSIESVQMEADNCVTDSLTIYDSLLPIR
SAILYRICEPTRTIMSFVSTNNLMLVSFKSPHIRRLSGIRAFFEVIPEEKCENTVLVKEI
TGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGVALKFHNYSITKKSVKGCDHGWWEIN
EHMYCGFYVDHQTIFRVPGPLAHIQLRCSSRLSDKPLLVEYGSYNISQPCPAGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVTLKPACNTSSFRQHGRLVCDGFRDCEDGQDEQNCT
QSIPCNDRTFKCGNNICFRKQNAQCDGTVDCPDGSDEEGCSCSRGSSTFHRIIGGTDTQE
GGWPWQVSLHFVGSAYCAASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVKRIVVHEYYNSQTFDYDIALLQLGTAWPGTLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADNKGSPVLQQAEVELIDQTLCVSTYGIITSRMLCAGVMSGKRDACRGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences G1MIJ1
ENSAMEP00000019176 ENSAMEP00000019176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]